KEGG   Bacillus subtilis subsp. subtilis 168: BSU38900
Entry
BSU38900          CDS       T00010                                 

Gene name
yxjM
Definition
(RefSeq) sensor histidine kinase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HisKA_3 HATPase_c Hpt HATPase_c_2 Peptidase_U4
Other DBs
NCBI-GeneID: 937441
NCBI-ProteinID: NP_391769
Pasteur: BG11896
BSORF: BG11896
UniProt: P55183
Position
3993162..3994382
AA seq 406 aa
MNGQTPARHYYKKLVPSLILILNCIQFLSHPTKADPILLAFVFAVYLAFIWIIPYVASTA
VSLSIFIGLWLLTDFFWAVSGQEQGAAYFLIVFLMIYAAFRLPSRLSLIFTACLIGGNIL
LLSSQGGSLNTIISNISIMLGLYVLFSSMRFRREARREAERNHAELAKMHVQLEHAHKEL
QKAHAELQEASVLSLRYAVLEERTRIARDIHDSIGHELTSVIVQLQSLPYILKSSKEDSE
KVIQNVLSVARECLQEVRSVVHQMGRSESMVGLTALRGLIHQVEERSGLHVSLDTAGLSE
ESWPPNVSETIYRILQEALTNIIRHADASHAAAVISNDKSHLYVTITDDGQFTGSLTYGF
GLTGMKERAEKAGGSLTFSAVQPSGLKIELSLPLMTTNKEQKDEQR
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaacggacaaactccggctcggcactactacaagaagcttgtgccgagccttattctc
attttgaattgcatacaatttttatctcatccaactaaggctgatcccattttgttagca
tttgtatttgcggtatacttagcattcatttggatcattccctatgtggcatccactgct
gttagtttgagcatattcatcggactctggctcctgaccgatttcttttgggctgtttcc
ggccaagagcagggtgccgcctattttttgattgtatttttaatgatatatgccgccttt
agactcccttcacggctatccttgatcttcacagcatgtttaattggaggcaacatatta
ctcctatcctcacaagggggaagcttgaataccatcatcagcaacatctcgatcatgctc
ggtctgtacgtcctcttctcctccatgcgtttcagacgagaagcgagaagggaggctgaa
cggaatcatgctgaattggcaaaaatgcatgtgcagctggagcatgctcataaagaactc
cagaaagcgcatgcagagctgcaggaggcttctgttctttcattaaggtacgcggtcctt
gaggaacgtacaagaattgcccgcgacattcatgacagcatcggtcacgagctgacttct
gtgattgttcagcttcaatcccttccctatatccttaaaagcagcaaggaggattcagaa
aaagtcattcaaaatgtactgagtgtcgccagggagtgtcttcaagaagtgcggtctgtt
gttcaccaaatgggccgtagtgaatcgatggtggggcttaccgctttgcgggggctcatt
catcaagtggaggaacggagcggcttgcacgtttctttagatactgccggactgtcagaa
gagtcttggcctccaaacgtgagcgaaacgatctaccgcatcttgcaggaagcgctgacc
aatatcattcgtcacgctgacgcttctcatgcggcggccgtcatttctaatgacaagtcc
catctctatgtcacaatcaccgacgacggacaattcaccggcagccttacttatggattt
ggcctgacaggaatgaaagagcgcgcagaaaaagcaggcggttcccttactttcagtgcc
gtacagccgagcggcctgaaaattgagctgtcattgccgctcatgacaacgaataaggag
caaaaagatgaacaaagataa

DBGET integrated database retrieval system