KEGG   Bacillus subtilis subsp. subtilis 168: BSU38910
Entry
BSU38910          CDS       T00010                                 

Symbol
yxjL
Name
(RefSeq) transcriptional regulator
  KO
K02479  two-component system, NarL family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU38910 (yxjL)
Two-component system [BR:bsu02022]
 NarL family
  Unclassified
   BSU38910 (yxjL)
SSDB
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_40 Sigma70_r4 HTH_23 HTH_24 HTH_11 Sigma70_ECF HTH_10 HTH_AsnC-type
Other DBs
NCBI-GeneID: 937427
NCBI-ProteinID: NP_391770
Pasteur: BG11895
BSORF: BG11895
UniProt: P55184 A0A6M3ZLP3
Position
3994369..3995025
AA seq 218 aa
MNKDKIRVALADDQPLVREGFRYVINAQTDMTVSGEAGDGHDIIALAKQTKPDVILMDVQ
MPRCSGIEAAKDIMSALPNTKIVILTTFDTEEYVFEGIRAGAVGYLLKDTLPEELIDAIR
AAARGEAIFRTVTAAKIISETFRAKQQTHAEELAEPFTKRELEVLQQMAYGLRNEDIAEK
LFVSESTVKTHVHRILQKCNAQDRTQAVVFAIRNGIVQ
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaacaaagataaaatacgcgtagcgcttgccgatgatcagccgcttgtgcgtgaaggc
ttccgctacgtcatcaacgcacagacggatatgacggtttctggcgaggccggcgacggt
cacgatattatagcactcgcaaaacaaacaaaacccgatgtcatcctcatggatgtccag
atgccgcgttgctcaggcatcgaagcggcgaaagacattatgtccgcacttccaaataca
aagatagtcattttaaccacctttgacacggaagaatacgtatttgaaggcatccgtgcg
ggcgcagtcggctatctgctgaaggatacacttcctgaggagttgatagatgcgattcgc
gctgcggccagaggcgaggcgattttccgtacagtcacagctgctaaaatcatcagtgag
acatttcgggcgaaacagcaaactcatgccgaagaactggcagagccgttcaccaaaaga
gagcttgaggttcttcagcaaatggcctacggactgagaaatgaggatattgctgaaaag
cttttcgtcagtgaaagcactgtgaaaacccacgtgcaccgcatcctgcaaaaatgcaat
gcccaagaccggacacaggcagtcgtttttgccattcgaaacggtattgtgcaatag

DBGET integrated database retrieval system