KEGG   Bacillus subtilis subsp. subtilis 168: BSU38920
Entry
BSU38920          CDS       T00010                                 

Symbol
pepT
Name
(RefSeq) peptidase T
  KO
K01258  tripeptide aminopeptidase [EC:3.4.11.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU38920 (pepT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.4  tripeptide aminopeptidase
     BSU38920 (pepT)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M20
   BSU38920 (pepT)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 DUF5847
Other DBs
NCBI-GeneID: 937428
NCBI-ProteinID: NP_391771
Pasteur: BG11842
BSORF: BG11842
UniProt: P55179 A0A6M4JQL8
Position
3995075..3996307
AA seq 410 aa
MKEEIIERFTTYVKVDTQSDESVDTCPSTPGQLTLGNMLVDELKSIGMQDAAIDENGYVM
ATLPSNTEKDVPTIGFLAHVDTATDFTGKNVNPQIIESYDGKDIVLNEQLQVTLSPDQFP
ELSGYKGHTLITTDGTTLLGADNKAGIAEIMTAMDYLIKHPEIKHGTIRVAFTPDEEIGR
GPHKFDVKRFNASFAYTVDGGPLGELEYESFNAAAAKITIKGNNVHPGTAKGKMINSAKI
AMKLNSLLPADEAPEYTEGYEGFYHLLSIQGDVEETKLHYIIRDFDKENFQNRKETMKRA
VEELQNEYGQDRILLDMNDQYYNMREKIEPVIEIVNIAKQAMENLGIEPKISPIRGGTDG
SQLSYMGLPTPNIFTGGENFHGKFEYISVDNMVKAVNVIVEIAKQFEAQA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgaaagaagaaatcattgaacggtttactacatatgtaaaagtcgatacacagtccgat
gaatccgttgacacttgtccttccacacccggccaattgacattaggaaacatgctagtt
gatgaattgaagtccatcggcatgcaggatgcagccattgatgaaaacggctatgtcatg
gcaactcttccctccaatactgaaaaagacgtgccgacaatcggctttctcgctcacgtc
gacaccgctacagactttaccggcaaaaatgtgaatccgcaaatcatcgaaagctatgat
ggaaaagacatcgttcttaacgaacagctgcaggtcaccctgtcacctgatcaattccct
gagctgtccggctataagggccatacactcatcaccacagacggcaccacccttctcggc
gcagacaataaggccggtatcgctgaaatcatgacagccatggattacctcatcaaacac
cctgaaatcaagcacggcacaatcagagtcgcctttacgcctgatgaagaaatcggaaga
gggccgcacaaatttgatgtgaaacggttcaatgcatcctttgcctacacggttgacggc
gggccgctcggcgagcttgaatatgaaagcttcaatgccgctgccgcaaaaattacgatt
aaaggcaacaacgtacatcccggaacagctaaaggaaaaatgatcaactctgcgaaaatc
gcgatgaagctgaacagcctgctgccggcagacgaagcgcctgaatatacggaaggttat
gaaggcttctaccacctgctgtcgattcaaggagacgtagaggaaacaaagctccactac
attatcagagactttgacaaagagaatttccaaaacagaaaagaaacaatgaagcgtgcc
gttgaagaacttcaaaacgaatacgggcaagaccggattctgctggatatgaacgaccaa
tactacaacatgagagagaaaattgaacctgtcatcgaaatcgtcaacattgccaagcaa
gcgatggaaaacctcggcatcgaaccgaagatttcccccatccgcggcggaaccgacgga
tcacagctgtcctacatggggcttccgacgccaaacatctttacaggcggggaaaacttc
cacggcaaatttgaatacatctcagttgacaacatggtcaaagccgtaaatgtcatcgtt
gagattgcaaagcagtttgaagcgcaagcataa

DBGET integrated database retrieval system