KEGG   Bacillus subtilis subsp. subtilis 168: BSU38930
Entry
BSU38930          CDS       T00010                                 

Symbol
yxjJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937454
NCBI-ProteinID: NP_391772
Pasteur: BG12540
BSORF: BG12540
UniProt: P94353 A0A6M3ZHJ5
Position
3996829..3997092
AA seq 87 aa
MLFIDLEFFEYFLAFYPYNREYQNFFWEVCNMILFIIIALCGYLLFSFSKDNRRKPQKTS
PLPAAAPHHNNLIDLDAIRQKRRMHLS
NT seq 264 nt   +upstreamnt  +downstreamnt
ttgttatttattgatttagaattttttgaatactttttggcattttatccgtacaataga
gagtaccaaaactttttttgggaggtatgtaatatgatcctatttattatcatcgcatta
tgcggctatcttcttttttctttcagcaaggacaatcgccgcaaaccgcaaaagacaagc
cctctgccagcagccgcacctcatcacaacaacctaatcgaccttgacgccatccgccaa
aaacgccggatgcatctttcctaa

DBGET integrated database retrieval system