KEGG   Bacillus subtilis subsp. subtilis 168: BSU38950
Entry
BSU38950          CDS       T00010                                 

Symbol
yxjH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1
Other DBs
NCBI-GeneID: 937440
NCBI-ProteinID: NP_391774
Pasteur: BG11157
BSORF: BG11157
UniProt: P42319 A0A6M3ZHZ6
Position
3997964..3999097
AA seq 377 aa
MAQQTNVAGQKTEKQRKAPFRADHVGSLLRSVPVKEARQKKAAGEMTAEQLRDIENQEIT
RIVEKQKEIGLDVVTDGEFRRSWWHYDFLEGLDGVEPFIPAEGIQFHNTKTKARSIKVTG
KLDFTSHPALGDYQFLHEIAGNATPKLTIPSPNMLFFGEKADKGIYDDQEEYFHDMAQAY
KKAIKAFYDAGCRYLQLDDTSWSLFFEDKGREVVRALGGDPETLPAIFAKTINDAVADRP
DDLTITMHICRGNFRSTWAASGGYDAVAETILDGLNLDGLFLEYDDDRSGNFDPLRFVKR
KDLQIVLGLITSKYGELENPEDVKRRINEAARFVSLDQLCLSPQCGFASTEEGNLLTEEQ
QWAKLRHVIDIANDVWR
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggctcaacaaacgaatgttgcaggacaaaaaacagaaaaacaacgcaaagcacctttc
cgcgccgatcatgtcggcagcttgcttcgttccgttccggtaaaggaagcccggcaaaaa
aaagcggctggtgagatgacagcggaacagcttcgtgatatcgaaaatcaagagatcacc
cgcatcgtggaaaaacaaaaagaaatcggtctcgatgtggtaacagacggggaattccgg
cgttcctggtggcattatgacttcctggaagggcttgacggtgtggaaccgttcatcccg
gctgaggggattcagttccataacacaaaaacgaaagcgcgcagcatcaaagtgacggga
aaactcgattttacgagccacccagcgctcggtgattatcaatttttacatgagattgcc
ggtaacgcgacgccaaaattgaccattcccagtccaaatatgctgttttttggcgaaaag
gcggataaagggatttatgacgatcaagaggaatactttcatgatatggcccaagcgtac
aaaaaagcaatcaaagccttctatgatgctggctgccgttatctccagcttgatgatacg
tcatggtctctcttctttgaggacaaaggcagagaggttgtccgggcgctcggcggtgat
ccagaaacattgccagccatatttgccaaaacaattaacgatgccgtcgcagaccggcct
gacgatttaacgatcacaatgcacatttgccgcggcaacttccgctcaacctgggcggca
tcaggagggtacgacgctgtagcggaaacgattttggacggcttaaaccttgacggcctt
ttcttggaatacgatgatgaccgctccggaaactttgatccgctccgttttgtgaagcgc
aaggatctgcaaattgtgctcggcttgatcacatcgaaatacggcgagcttgaaaatcct
gaggatgtgaaacgccgtatcaatgaagccgcgcgttttgtcagcttggaccagctatgc
ctgagcccgcagtgcggtttcgcctctacagaagaaggcaaccttctgacagaggagcag
caatgggcaaagctgcgccatgtcatcgacattgccaacgatgtgtggagataa

DBGET integrated database retrieval system