KEGG   Bacillus subtilis subsp. subtilis 168: BSU38970
Entry
BSU38970          CDS       T00010                                 

Symbol
yxjF
Name
(RefSeq) oxidoreductase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU38970 (yxjF)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BSU38970 (yxjF)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N Polysacc_synt_2 Methyltransf_25 Methyltransf_23 RmlD_sub_bind NAD_binding_2 TrkA_N YjeF_N
Other DBs
NCBI-GeneID: 937450
NCBI-ProteinID: NP_391776
Pasteur: BG11155
BSORF: BG11155
UniProt: P42317 A0A6M4JQP2
Position
complement(4000539..4001312)
AA seq 257 aa
MRKQVALVTGAAGGIGFEIAREFAREGASVIVSDLRPEACEKAASKLAEEGFDAAAIPYD
VTKEAQVADTVNVIQKQYGRLDILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMK
HVFPIMKKQQFGRIINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNAL
CPGYVDTQLVRNQLSDLSKTRNVPYDSVLEQVIFPLVPQKRLLSVKEIADYAVFLASEKA
KGVTGQAVVLDGGYTAQ
NT seq 774 nt   +upstreamnt  +downstreamnt
atgagaaaacaagtcgctttggtgacaggggctgccggcggaatcggattcgaaatcgca
agagaattcgcccgggaaggtgccagcgtcatcgtttcagacctccgtccggaagcatgt
gaaaaagcagcctccaagcttgcagaagaaggctttgacgcggcggccattccgtatgat
gtgacaaaggaagcgcaagttgctgatacggtgaacgtcatccaaaaacaatacggccgc
ttggatattctggtgaacaatgccggtattcagcacgtcgctccgattgaagagtttccg
acagacacctttgaacagctgatcaaggtcatgctgacggctccctttattgcaatgaag
catgtttttccgatcatgaaaaaacagcagtttggcagaatcattaatattgcgtctgtt
aatggattagtgggctttgcagggaaatccgcttataatagcgccaagcacggcgtcatt
ggactcacaaaagtaggggcgctggaaggcgcgccccacggcataacagtcaatgcgctc
tgtccgggttatgtcgatacccagcttgtacgcaatcagcttagcgatctatcgaaaact
agaaatgtcccttacgactctgtacttgaacaagtcatttttccgcttgtgccgcaaaag
cgactgctttccgtcaaggaaattgcggattatgccgtgtttttggcaagcgagaaggcg
aagggcgtcactgggcaggctgtcgtccttgatgggggctacaccgcacaatga

DBGET integrated database retrieval system