KEGG   Bacillus subtilis subsp. subtilis 168: BSU38990
Entry
BSU38990          CDS       T00010                                 

Symbol
scoA
Name
(RefSeq) succinyl-CoA:3-ketoacid coenzyme A transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU38990 (scoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU38990 (scoA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     BSU38990 (scoA)
SSDB
Motif
Pfam: CoA_trans
Other DBs
NCBI-GeneID: 937468
NCBI-ProteinID: NP_391778
Pasteur: BG11153
BSORF: BG11153
UniProt: P42315 A0A6M4JQN0
Structure
PDB: 
3CDK

Position
complement(4001976..4002692)
AA seq 238 aa
MGKVLSSSKEAAKLIHDGDTLIAGGFGLCGIPEQLILSIRDQGVKDLTVVSNNCGVDDWG
LGLLLANKQIKKMIASYVGENKIFERQFLSGELEVELVPQGTLAERIRAGGAGIPGFYTA
TGVGTSIAEGKEHKTFGGRTYVLERGITGDVAIVKAWKADTMGNLIFRKTARNFNPIAAM
AGKITIAEAEEIVEAGELDPDHIHTPGIYVQHVVLGASQEKRIEKRTVQQASGKGEAK
NT seq 717 nt   +upstreamnt  +downstreamnt
atgggaaaagtgctgtcatcaagcaaggaagctgcgaaactgattcatgatggggatacg
ctgatcgcgggagggtttgggctgtgcggcatccctgaacagctcattttgtctataaga
gatcagggagtaaaggatttaaccgttgtcagcaataactgcggagtcgatgactggggg
cttggtttgcttctggctaacaagcaaatcaagaaaatgatcgcttcctatgtcggtgaa
aataaaatttttgagcggcagtttttaagcggagagcttgaggtagagcttgttccccaa
ggaacgctcgctgagagaattcgtgcaggcggtgcaggcataccgggattttatacggcg
acaggcgtcggcacctccatagccgagggaaaagaacataaaacattcggcggccggact
tatgtgctggagcgaggcattaccggcgatgtggcgatcgtcaaagcgtggaaagcggac
accatgggcaatttgatttttaggaaaacggcgagaaatttcaatcccattgccgccatg
gcaggcaagatcacgattgccgaggcggaagaaatcgtggaagcaggagagctcgatcca
gatcacatccatacgccgggaatttacgtacagcatgtcgtgcttggcgcgagccaagaa
aaacggattgaaaaacgaacagttcagcaagcatcgggaaagggtgaggccaagtga

DBGET integrated database retrieval system