KEGG   Bacillus subtilis subsp. subtilis 168: BSU39000
Entry
BSU39000          CDS       T00010                                 

Symbol
yxjC
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GntP_permease CitMHS
Other DBs
NCBI-GeneID: 937455
NCBI-ProteinID: NP_391779
Pasteur: BG11152
BSORF: BG11152
UniProt: P42314 A0A6M3ZI61
Position
complement(4002716..4004134)
AA seq 472 aa
MELIIILLALGLLMFTAYRGFSVILFAPICALFAVLLTDPSHVLPFFSSIFMEKMAGFIK
LYFPVFLLGAIFGKVVEMAGLAASIAKTIVRLVGAKRAILAIVLMGAVLTYSGVSLFVVV
FAVYPFAKNMFQEANIPKRLIPGTIALGAFTFTMDALPGTPQIQNVIPTSFFKTDIYAAP
WLGLMGAVIVLAAGMLYLESRRKKAQASGEGYGGFDSQNAPAPESIESAAEPDKSPIRHA
LAFVPLILVGAVNKYFTIYLPKWYPNGFDFSSIGLKEFGRLDISSAAAIWSVEIALVIGI
ITTILFDWRSVFAQLKEGLNEGIGGALLASMNTGAEYGFGGIIAALPGFHKLSSGISHTF
TDPLVNGAVTTTALAGITGSASGGMGIALSAMSEQYLQAIQAYNIPPEVMHRVISMASGG
MDTLPHNGAVITLLAVTGLTHRQSYRDIFAITLIKTAAVFAVIAIYSLTGLV
NT seq 1419 nt   +upstreamnt  +downstreamnt
gtggaactgatcatcattctattggcgttaggtttgctgatgtttacggcgtatcgggga
ttttctgtcatattgtttgcgccgatttgcgcgttattcgcggtgctgctgacagatcca
agccatgtgcttccttttttttcatcaatttttatggagaagatggcgggttttattaag
ctgtatttcccagtgtttttgctcggtgctatttttggaaaggtcgttgaaatggccggg
cttgcggcatcaatcgcgaaaacaattgtccggcttgtcggggcaaaaagagcgatactt
gccattgtgctgatgggtgctgtcttgacgtacagcggtgtcagcctgtttgttgtcgta
tttgctgtatatccttttgcgaaaaacatgttccaagaagcaaacataccaaaacgcctc
atcccgggtacgattgctttaggagcttttacgtttacgatggacgcacttccgggaacg
ccgcaaatccaaaatgtcatcccgacgtcgtttttcaaaacagacatttatgccgcccct
tggctgggtttgatgggcgcagtgattgtgctggcagctgggatgctctatttggaatca
aggcggaagaaagcgcaggcatctggcgaaggctatggcggttttgattcgcagaatgct
cctgctcctgaatcgattgagtccgcggctgaaccggacaaaagcccgattcggcacgcg
cttgcctttgtcccgcttattctcgtcggtgcagtgaataaatatttcaccatttacctg
ccaaagtggtatccgaatggatttgatttttcttccataggattaaaggagttcggcagg
cttgatatttcttcagcggctgctatttggtcggtggagattgctttagtgattggcatc
atcacaacgatattatttgattggagaagtgtgtttgcccaattgaaggaagggctgaat
gaaggaattggcggcgccttgctggcatctatgaatacgggtgctgagtacgggttcggc
ggcattatcgccgcgctgccggggtttcataagctgagcagcggaatttcacatactttt
accgatccgcttgtaaatggcgccgttacgacaactgcgctggcgggaatcaccggctcg
gcttcgggaggaatgggcattgcgttaagcgcgatgtcagaacaatacttacaggcgatt
caggcttacaatattccgccagaggtgatgcatcgggtcatttcaatggcatcaggcggg
atggatacactgccgcataatggcgccgttatcacgcttctggccgtgacgggtttgacc
caccggcaatcctatcgcgatatttttgcgatcacgctcattaaaacggctgccgtattt
gctgtgatcgcgatttacagcctgactggtctagtgtag

DBGET integrated database retrieval system