KEGG   Bacillus subtilis subsp. subtilis 168: BSU39010
Entry
BSU39010          CDS       T00010                                 

Symbol
yxjB
Name
(RefSeq) 23S rRNA (guanine-N(1)-)-methyltransferase YxjB
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU39010 (yxjB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     BSU39010 (yxjB)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU39010 (yxjB)
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 MetW Methyltransf_23 Methyltransf_12
Other DBs
NCBI-GeneID: 937456
NCBI-ProteinID: NP_391780
Pasteur: BG11151
BSORF: BG11151
UniProt: P42313 A0A6M3ZLP8
Position
complement(4004288..4005136)
AA seq 282 aa
MKRTVDFSMFRCPLCDSSMDAASGKSLICTERGHTFDLSRHGYVNFLTKPVKTSYGAELF
EARSRLIGECGFFDPLHDAIAELISHPKSGHEAFTILDSGCGEGSHLNALCGFDYAGKAA
IGTGIDLSKDGILKASKAFKDLMWAVADVARAPFHDRQFDVVLSIFSPSNYAEFHRLLKN
DGMLIKVVPRSDYLIELRQFLYTDSPRRTYSNTAAVERFTANAAHSRPVRLRYVKTLDQQ
AIHWLLKMTPLAWSAPKDRVSLLKEMKSADITVDVDILIGMK
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaagcgaacagttgatttcagcatgtttcgatgcccgctctgcgattcttctatggat
gcggcatcagggaaaagcttgatttgtacagaacgaggacatacatttgatctatctcgg
cacggctacgtgaactttctgacgaagccggtcaaaaccagttacggtgccgagcttttt
gaagcgaggagcaggctgattggagaatgtggtttttttgacccgctccatgatgcgatt
gcagagctcatcagtcatcccaaatctggtcatgaggcattcaccatcttggacagcggt
tgcggtgagggttctcatttgaatgcgctttgcgggtttgattatgcagggaaagcagcg
ataggaaccggcatagatctttcgaaggacgggatcttaaaagcttctaaggcattcaaa
gatctgatgtgggcggttgccgatgtggcgcgtgctccttttcatgatcgccaatttgat
gttgttctgtctattttttcgccgtccaattatgcagagtttcatagactgctgaagaat
gatggcatgctcataaaagtagtgccgcgaagcgactatttaatagaattaaggcaattt
ttatatactgattcaccaaggcgcacgtattccaatacggcagcagttgagcgttttaca
gcaaatgcagcacacagccgtcctgtcaggctgcgctatgttaaaacgcttgaccagcag
gcgatccactggcttctcaagatgacgccgcttgcctggtcggcgccgaaagatcgagtc
agcctgctgaaagagatgaaatcagccgatattacggttgatgttgatatcctaatagga
atgaaatga

DBGET integrated database retrieval system