KEGG   Bacillus subtilis subsp. subtilis 168: BSU39020
Entry
BSU39020          CDS       T00010                                 

Symbol
yxjA
Name
(RefSeq) purine nucleoside transport protein NupG
  KO
K16323  purine nucleoside transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39020 (yxjA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU39020 (yxjA)
SSDB
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N
Other DBs
NCBI-GeneID: 937472
NCBI-ProteinID: NP_391781
Pasteur: BG11150
BSORF: BG11150
UniProt: P42312 A0A6M4JQM9
Position
4005752..4006945
AA seq 397 aa
MYFLLNLVGLIVIMAVVFLCSPQKKKIKWRPIITLIVLELLITWFMLGTKVGSWAIGKIG
DFFTWLIACASDGIAFAFPSVMANETVDFFFSALLPIIFIVTFFDILTYFGILPWLIDKI
GWVISKASRLPKLESFFSIQMMFLGNTEALAVIRQQLTVLSNNRLLTFGLMSMSSISGSI
IGSYLSMVPATYVFTAIPLNCLNALIIANLLNPVHVPEDEDIIYTPPKEEKKDFFSTISN
SMLVGMNMVIVILAMVIGYVALTSAVNGILGVFVHGLTIQTIFAYLFSPFAFLLGLPVHD
AMYVAQLMGMKLATNEFVAMLDLKNNLKSLPPHTVAVATTFLTSFANFSTVGMIYGTYNS
ILDGEKSTVIGRNVWKLLVSGIAVSLLSAAIVGLFVW
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtactttttactaaaccttgtcggtctcattgtgattatggcagttgtattcctatgt
tctccgcagaaaaagaaaatcaagtggcgcccgatcattacgttaattgttctggaattg
ctgattacttggtttatgctgggaacaaaagtcggaagctgggccatcggtaaaatcggt
gatttcttcacttggctgattgcttgcgccagtgacggtatcgcgtttgcctttccgtca
gtgatggcgaatgaaacagtagactttttctttagtgcgcttcttccaattatctttatc
gtcacattctttgatattttaacgtatttcggcattttgccttggctgattgataaaatc
ggatgggtgatttcaaaggcttcccgcttgccgaaattagaaagctttttctctattcaa
atgatgttccttggaaataccgaagcacttgcggtcatccgccagcagcttacggtttta
agcaacaaccgcctgctcacattcggtttaatgagcatgagcagcatcagcggctccatt
atcggatcttatctttcaatggtgcctgcgacatacgtgtttacagccattcctttgaac
tgcttaaacgcgctgattatcgcaaacctgctgaatcctgttcacgtgccggaggatgaa
gatatcatctatacaccgcctaaagaagagaagaaagactttttctctacgatttctaac
agtatgcttgtcggcatgaacatggttatcgttattttggcaatggtgatcggatatgtc
gcattaacgtcagcagttaatggcattcttggcgttttcgtacatggcctgaccatccag
acaatttttgcttatctgttcagtccgttcgcattcctgcttggactgccagtgcacgat
gcgatgtatgttgctcagctgatgggcatgaaattagcaacgaacgagtttgttgcgatg
cttgacttgaaaaacaatctcaaatcccttccgcctcacaccgttgcggtggcgacgaca
ttcctgacgtcctttgcaaacttcagtactgtcggcatgatttacggcacgtacaattcg
atccttgacggagaaaagtcaacggtcatcgggagaaacgtgtggaaactgctcgtcagc
ggaattgcggtatctttattaagtgctgcgattgtcggcctgtttgtgtggtag

DBGET integrated database retrieval system