KEGG   Bacillus subtilis subsp. subtilis 168: BSU39040
Entry
BSU39040          CDS       T00010                                 

Symbol
yxiS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1040
Other DBs
NCBI-GeneID: 937467
NCBI-ProteinID: NP_391783
Pasteur: BG11148
BSORF: BG11148
UniProt: P42310 A0A6M3ZHK2
Position
complement(4007803..4008093)
AA seq 96 aa
MNEKQLTEAYERDENMMILVFAQWCVNHDLDPMELYAKAYPQQKLNESLKKTMDDLVVPK
HEAEHIPDQTVIAVLEMFGNTDLAQALHEAISGRKQ
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaacgaaaaacagctcactgaagcttacgaacgcgatgaaaatatgatgattttggtg
tttgcccagtggtgcgtgaaccatgatcttgatccgatggagctgtacgccaaagcgtat
ccgcagcaaaagctgaatgaaagcttgaaaaaaaccatggacgatctggtcgtgccaaaa
cacgaagcagagcacattccggaccagactgtcattgcggtattagagatgttcggaaat
acagatttggcacaagcccttcatgaagcgatttctgggcgcaaacagtaa

DBGET integrated database retrieval system