KEGG   Bacillus subtilis subsp. subtilis 168: BSU39050
Entry
BSU39050          CDS       T00010                                 

Symbol
katE
Name
(RefSeq) catalase-2
  KO
K03781  catalase [EC:1.11.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00380  Tryptophan metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU39050 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BSU39050 (katE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BSU39050 (katE)
SSDB
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI OB_NTP_bind
Other DBs
NCBI-GeneID: 937481
NCBI-ProteinID: NP_391784
Pasteur: BG11102
BSORF: BG11102
UniProt: P42234 A0A6M3ZHW5
Position
complement(4008143..4010203)
AA seq 686 aa
MSDDQNKRVNEHSKDEQLEQYRTDNSGKKMTTNQGLRVSEDEHSLKAGVRGPTLMEDFHF
REKMTHFDHERIPERVVHARGFGVHGFFQVYEPMTEYTRAKFLQDPSVKTPVFVRFSTVA
GSKGSADTVRDARGFATKFYTEEGNYDLVGNNIPVFFIQDAIKFPDLVHAFKPEPHNEMP
QAATAHDTFWDFVANNPESAHMVMWTMSDRGIPRSYRMMEGFGVHTFRFVNEQGKARFVK
FHWKPVLGVHSLVWDEAQKIAGKDPDFHRRDLWETIENGGKVEYELGVQMIDEEDEFKFD
FDILDPTKLWPEELVPVKIIGKMTLNRNQDNVFAETEQVAFHPGNVVPGIDFTNDPLLQG
RLFSYTDTQLIRLGGPNFHEIPINRPVCPFHNNQYDGYHRMTINKGPVAYHKNSLQNNDP
SPATAEEGGYVHYQEKVEGKKIRQRSDSFNDYYSQAKLFWNSMSPVEKQHIISAFCFEVG
KVKSKDVQRQVVDVFSNVDADLAEEIAKGVGVAAPAKRKASKEILTSPALSQARTVKTAS
TRKVAVLAGNGFHEKELQTVLEALKQEGITVDIISQNLGYMTSGSGQQLEASGTFLTVDS
VLYDAVYAAGGLELKDNKQAMAFIREAYNHYKAIGAANEGIDLLQSSVGTTEGLGIVTAK
DEPDYTAFSKAFIDAVAAHRHWDRRI
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgagtgatgaccaaaacaaacgtgtaaatgaacactcaaaggacgagcagcttgagcag
tacaggaccgataacagcgggaagaaaatgacgacaaaccaaggcttgcgagtgtcagag
gatgagcactcgttaaaagccggggttcgcggcccgacgctgatggaggattttcatttc
cgggagaaaatgacgcactttgaccatgagaggattccggagcgcgttgtgcatgcgcgc
ggatttggcgtgcatggcttttttcaggtttacgaaccaatgacggaatacacacgggcc
aaatttcttcaggacccttcggtgaagacaccggtatttgtccgtttttctacggttgcg
ggttctaaaggctccgcagacacggtgcgggatgccagaggctttgcgacaaaattttat
actgaagaaggaaactatgaccttgtgggaaataacattccggtgtttttcattcaggac
gcaatcaaatttccggatttggttcacgcgtttaagcctgagccacacaatgaaatgcct
caggctgcgactgctcacgatacattttgggattttgtcgccaataaccctgagtctgcc
cacatggtgatgtggacgatgtctgacagaggcatcccgcgcagctacagaatgatggaa
ggcttcggcgttcacacgttccgttttgtcaatgaacaaggaaaggcacgtttcgtgaaa
tttcactggaagccggtgctcggcgtgcattctctcgtatgggatgaagcgcaaaaaatt
gccgggaaagatccagatttccaccgccgtgacctgtgggaaacaattgaaaacggcggc
aaggttgaatacgagctcggcgtgcagatgattgatgaggaagatgaattcaagtttgat
tttgatattcttgacccaactaagctgtggccggaagagcttgtgccggtgaagatcatt
ggaaaaatgacgctgaaccgcaatcaggataatgtgtttgcggaaacagaacaagtcgca
ttccacccgggaaatgtcgtgccgggcatcgattttaccaatgacccgctattgcagggg
cggcttttctcttatacggatacacagctcatccgtcttggcggcccgaacttccatgag
attccgattaaccggccggtctgtccattccataacaaccaatacgacggctatcaccgg
atgacgatcaataagggacctgtcgcttatcataaaaactcactgcaaaacaatgatccg
tcgcctgcgacagctgaagaaggcggctacgtccactatcaggaaaaagtcgagggcaaa
aaaatccgccagcgaagcgacagcttcaacgattattactcacaggcgaagcttttctgg
aacagcatgtctcctgtggagaaacagcacatcatttctgctttctgcttcgaggtcggg
aaggtcaaaagcaaagacgtacagcggcaggtcgttgatgtcttcagcaatgtcgatgca
gatttagcagaagaaatcgccaaaggagtaggcgtggcggcgcccgcgaagcgtaaagca
tctaaagaaattcttacttcgcctgcgttaagccaagcccgtacagtgaaaaccgcgtca
acaagaaaagtcgctgtactcgccggaaacggatttcatgaaaaagagctgcaaacagta
ctggaagccttaaagcaagaaggaatcacagtggatatcatcagtcaaaatctggggtat
atgacaagcggcagcggacagcagcttgaggccagcggcacgttcctgacggttgattct
gttctgtatgatgccgtctatgccgcaggaggactggagttaaaagacaacaaacaagcg
atggcgtttatcagagaagcttacaatcactacaaggcgatcggtgcggcaaatgaagga
attgaccttcttcaatcctctgtcgggacaacagaggggctaggcatcgtaacggctaaa
gatgaacctgactacaccgctttcagcaaggcatttatcgatgcggttgctgctcatcgc
cattgggatagacgaatttga

DBGET integrated database retrieval system