KEGG   Bacillus subtilis subsp. subtilis 168: BSU39060
Entry
BSU39060          CDS       T00010                                 

Symbol
citH
Name
(RefSeq) citrate transporter
  KO
K03300  citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU39060 (citH)
SSDB
Motif
Pfam: CitMHS Na_H_antiporter
Other DBs
NCBI-GeneID: 937469
NCBI-ProteinID: NP_391785
Pasteur: BG11146
BSORF: BG11146
UniProt: P42308 A0A6M3ZI09
Position
4010404..4011684
AA seq 426 aa
MLAILGFVMMIVFMYLIMSNRLSALIALIVVPIVFALISGFGKDLGEMMIQGVTDLAPTG
IMLLFAILYFGIMIDSGLFDPLIAKILSFVKGDPLKIAVGTAVLTMTISLDGDGTTTYMI
TIAAMLPLYKRLGMNRLVLAGIAMLGSGVMNIIPWGGPTARVLASLKLDTSEVFTPLIPA
MIAGILWVIAVAYILGKKERKRLGVISIDHAPSSDPEAAPLKRPALQWFNLLLTVALMAA
LITSLLPLPVLFMTAFAVALMVNYPNVKEQQKRISAHAGNALNVVSMVFAAGIFTGILSG
TKMVDAMAHSLVSLIPDAMGPHLPLITAIVSMPFTFFMSNDAFYFGVLPIIAEAASAYGI
DAAEIGRASLLGQPVHLLSPLVPSTYLLVGMAGVSFGDHQKFTIKWAVGTTIVMTIAALL
IGIISF
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcttgccatactcggttttgtgatgatgattgtctttatgtaccttattatgtctaac
cggctttccgctcttattgctttgattgtcgttcctattgtgtttgccctgatcagcgga
tttggcaaagatctcggcgagatgatgattcagggcgttacagacctcgcccctaccggt
atcatgctgttattcgccatcctgtatttcggcattatgattgactcaggcctgtttgat
cctctcattgccaaaatcttatcgtttgtcaaaggagatccgttaaaaatcgccgtaggc
acagcggttctgaccatgaccatttcgctggacggagatgggacaacaacctatatgatt
accattgcagcgatgctgcctctctacaaacggctcggcatgaaccgtttggtgttagcg
ggaatagcgatgcttggttcgggggttatgaatattatcccgtggggcgggccgactgcg
agggttttggcttccttaaaattggacacgtcagaggtctttacaccgctgattcccgct
atgatcgccggcattctctgggtgatcgccgttgcttatatcctcggaaagaaagagcgg
aagcggctcggcgtcatttcgattgatcacgcaccgtcttccgacccggaggccgcaccg
ctcaagcgtcccgctcttcaatggtttaacctgctgctgactgtcgctctgatggccgca
ctgatcaccagcctgctgccgctccctgttctttttatgactgcgttcgccgttgccttg
atggttaactatccaaatgtcaaagagcagcagaaacgaatctcggcgcatgcgggtaat
gcgttaaacgttgtctcaatggtgtttgctgcgggcatattcacaggcattctctccggc
acaaaaatggtggatgccatggcgcattctctcgtttcactcatccctgatgccatgggc
ccgcacctgccgttgatcactgcgatcgtcagcatgcccttcacctttttcatgtcgaat
gacgccttttacttcggtgtccttcccatcatcgccgaagccgcttccgcttacggaata
gacgccgctgaaatcgggagggcctccttgctggggcagcctgtgcatctgctcagcccg
cttgtgccttccacctatctattggtaggaatggcaggcgtcagctttggcgaccatcaa
aaattcactattaaatgggccgtgggaacaacgattgtgatgaccattgcggcgcttttg
attgggattatttctttctaa

DBGET integrated database retrieval system