KEGG   Bacillus subtilis subsp. subtilis 168: BSU39070
Entry
BSU39070          CDS       T00010                                 

Symbol
bglS
Name
(RefSeq) beta-glucanase
  KO
K01216  licheninase [EC:3.2.1.73]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU39070 (bglS)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.73  licheninase
     BSU39070 (bglS)
SSDB
Motif
Pfam: Glyco_hydro_16 Laminin_G_3
Other DBs
NCBI-GeneID: 937470
NCBI-ProteinID: NP_391786
Pasteur: BG10476
BSORF: BG10476
UniProt: P04957 A0A6M3ZHM3
Structure
PDB: 
3O5S

Position
complement(4011842..4012570)
AA seq 242 aa
MPYLKRVLLLLVTGLFMSLFAVTATASAQTGGSFFDPFNGYNSGFWQKADGYSNGNMFNC
TWRANNVSMTSLGEMRLALTSPAYNKFDCGENRSVQTYGYGLYEVRMKPAKNTGIVSSFF
TYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGAGNHEKIVDLGFDAANAYHTYAFDWQ
PNSIKWYVDGQLKHTATNQIPTTPGKIMMNLWNGTGVDEWLGSYNGVNPLYAHYDWVRYT
KK
NT seq 729 nt   +upstreamnt  +downstreamnt
atgccttatctgaaacgagtgttgctgcttcttgtcactggattgtttatgagtttgttt
gcagtcactgctactgcctcagctcaaacaggtggatcgttttttgacccttttaacggc
tataactccggtttttggcaaaaagcagatggttattcgaatggaaatatgttcaactgc
acgtggcgggctaataacgtatcaatgacgtcattgggtgaaatgcgtttagcgctaaca
agcccagcttataacaagtttgactgcggggaaaaccgttctgttcaaacatatggctat
ggactttatgaagtcagaatgaaaccagctaaaaacacagggatcgtttcatcgttcttc
acttacacaggtccaacagatggaactccttgggatgagattgatatcgaatttttagga
aaagacacaacgaaggttcaatttaactattatacaaatggtgcaggaaaccatgagaag
attgttgatctcgggtttgatgcagccaatgcctatcatacgtatgcattcgattggcag
ccaaactctattaaatggtatgtcgacgggcaattaaaacatactgcaacaaaccaaatt
ccgacaacacctggaaagatcatgatgaacttgtggaatggcacgggtgtcgatgaatgg
cttggctcctacaatggtgtaaatccgctatacgctcattatgactgggtgcgctataca
aaaaaataa

DBGET integrated database retrieval system