KEGG   Bacillus subtilis subsp. subtilis 168: BSU39080
Entry
BSU39080          CDS       T00010                                 

Symbol
licT
Name
(RefSeq) transcription antiterminator LicT
  KO
K03488  beta-glucoside operon transcriptional antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU39080 (licT)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   BglG family
    BSU39080 (licT)
SSDB
Motif
Pfam: PRD CAT_RBD RbsD_FucU
Other DBs
NCBI-GeneID: 937503
NCBI-ProteinID: NP_391787
Pasteur: BG10474
BSORF: BG10474
UniProt: P39805 A0A6M3ZHU4
Structure
PDB: 
1H99 1TLV 1L1C

Position
complement(4012866..4013699)
AA seq 277 aa
MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDVSEKFK
TLLYDIPIECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLW
ETKRLYKDEFAIGKEALVMVKNKTGVSLPEDEAGFIALHIVNAELNEEMPNIINITKVMQ
EILSIVKYHFKIEFNEESLHYYRFVTHLKFFAQRLFNGTHMESQDDFLLDTVKEKYHRAY
ECTKKIQTYIEREYEHKLTSDELLYLTIHIERVVKQA
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaaattgcgaaggtgatcaacaataatgtgatcagcgtggtcaatgaacaggggaaa
gaattggtcgtcatgggcagggggctcgcgtttcagaaaaagtccggcgatgatgtcgat
gaagcccgcattgagaaagtgttcacgctcgataacaaggatgtatcagaaaagttcaaa
acccttttgtatgatataccgatcgagtgtatggaagtatccgaagagattatcagctac
gcaaaattacagctcggcaaaaagctcaacgacagcatctatgtgtcgctgaccgaccat
attaactttgccatccagcgcaaccagaaagggcttgatatcaaaaacgccttgctgtgg
gaaacaaaacggctctacaaagacgaatttgcgatcggcaaagaagcgttggttatggta
aaaaacaagactggtgtgtctctgccagaggatgaagcaggctttattgctctgcatatt
gtaaatgccgagctgaatgaagagatgcccaatattatcaacattacaaaagtcatgcaa
gagattttgagtattgtaaaataccattttaagattgaattcaacgaagaatcgcttcac
tattatcggttcgtcacccacttaaagtttttcgcgcagcgtctatttaacggcactcac
atggaaagccaggacgattttttgctggatacagtgaaagaaaagtatcatcgcgcgtat
gaatgcacgaagaaaatccaaacctacattgagcgggagtatgagcacaagctcacaagt
gacgagctgctgtatttaaccattcacatagaaagggtagttaaacaagcataa

DBGET integrated database retrieval system