KEGG   Bacillus subtilis subsp. subtilis 168: BSU39090
Entry
BSU39090          CDS       T00010                                 

Symbol
yxiP
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Methyltransf_10 LMBR1
Other DBs
NCBI-GeneID: 937473
NCBI-ProteinID: NP_391788
Pasteur: BG11145
BSORF: BG11145
UniProt: P42307 A0A6M4JQS7
Position
complement(4013795..4014475)
AA seq 226 aa
MRRIGLCISLLVTVLVMSACESEGEAQMFADCDQKTVKQTAAKPMSSKKKQDFQALASDR
QLAIVFSSMIQVSEAFDYGIGNPEYFVRISMTEEEADIAKENLESIKLENKSLKKQNSEA
VALLQKTRNQDMSRIEIQQLTENRAGFFETADSMIKLINQVTPKNAKKTRQQLDQLKKQY
TQYSAESIKIMNSIVKKQKADKASFERHLEALLQKQPGQQVRSELY
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaggcgaataggcttgtgtataagcctgctggtcacagttcttgtgatgagcgcatgc
gaaagtgaaggtgaggctcagatgttcgcagactgtgatcaaaagacagtaaaacaaacc
gcagccaaaccgatgagcagtaagaaaaagcaggatttccaagccctcgcaagcgacagg
cagctggccattgtgttcagttccatgatacaagtgagcgaagcatttgattatggaatc
ggcaatccagaatacttcgtgcgaatcagcatgactgaagaagaagcagacattgcgaag
gagaatctcgaatcgattaagcttgagaacaaatcgctcaaaaaacaaaacagcgaggcg
gttgccttgcttcaaaaaacgcgtaatcaagatatgagccgcatcgaaattcagcagctg
acagaaaatagagccggtttttttgagaccgcagacagtatgatcaaactcatcaaccaa
gtcacaccgaaaaacgcgaagaagacaagacagcagctggatcagctgaaaaaacaatat
acacaatacagtgctgaaagcattaaaatcatgaacagcattgtcaaaaagcagaaagct
gacaaggcatcatttgaacgccatctggaggcgctgcttcaaaaacagcccgggcagcag
gtacggagtgaattgtactga

DBGET integrated database retrieval system