KEGG   Bacillus subtilis subsp. subtilis 168: BSU39100
Entry
BSU39100          CDS       T00010                                 

Symbol
yxiO
Name
(RefSeq) MFS transporter
  KO
K06902  MFS transporter, UMF1 family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bsu04131]
    BSU39100 (yxiO)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39100 (yxiO)
Membrane trafficking [BR:bsu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    BSU39100 (yxiO)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    BSU39100 (yxiO)
SSDB
Motif
Pfam: ATG22 MFS_1 MFS_1_like DUF347 MFS_2
Other DBs
NCBI-GeneID: 937480
NCBI-ProteinID: NP_391789
Pasteur: BG11144
BSORF: BG11144
UniProt: P42306 A0A6M4JQP0
Position
4014682..4015968
AA seq 428 aa
MMKRFTKQENSWVLYDWANSAYSIVVTTAVFPLFYKSAAAESGVSAAQSTAYLGYTIAIS
TFILAMLGPILGTIADYEGCKKKFFGFFVSAGVASTAMLAFIPSEHWLLLLLFYTVSAIG
FSGANVFYDAFLVDVTPEKRMNLVSARGFGLGYIGSTIPFIISIAVILLAQAETIPVSVS
AASQLSFFITAAWWGLFTIPMIKHVHQRYYIKKEPHIVINSFKRLGQTMKRIRQYRALFL
FLLAYFFYIDGVGTIITMSTSYGSDLGIGSSSLLIILFVTQVVAAPFSIIYGKLAERFTG
KTMLYVGIVIYMIVCVYAYFMETTLDFWILAMLVATSQGGIQALSRSYFAKLVPKRHANE
FFGFYNIFGKFASIMGPLLIAVTAQLTGKSSTAVFSLIILFVIGIVILAFVPEETSTDVS
QQQNDLPL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgatgaaacgttttacgaaacaagaaaacagctgggtgttatatgactgggcaaattca
gcttactcaattgtcgtgaccaccgcggtatttccgttattttataaatcagcagctgcg
gaaagcggtgtcagcgccgctcaatcgactgcctatctgggctataccattgcgatttca
acgtttattcttgcgatgctcggccctattttaggcacaatcgccgactatgaagggtgc
aagaaaaagttcttcggtttctttgtgtcagccggtgtcgccagcaccgcgatgctcgcc
tttatccctagtgaacattggctgctattgttgctgttttatacggtatcggctatcggt
ttttccggcgccaatgtgttttatgatgcctttctcgtggacgtcacgcctgagaagcgg
atgaatctcgtctcggcacggggttttggcttaggatacattggaagcacgattccattt
atcatcagtattgctgtcatcctgctcgcacaagcagagactattccagtgtctgtatcg
gccgcaagccagctgtccttcttcataacggctgcctggtgggggctgttcaccatccca
atgattaaacatgtccatcaacgctattacatcaaaaaagaacctcatattgtcatcaac
agctttaagcggctcggccaaacgatgaaacggatcaggcaataccgggcacttttcctc
ttcttgctcgcttatttcttttatatcgacggagtcggcacgattattacgatgtcgaca
tcctatggatcagatttagggatcggctcctcaagccttctgatcatcctatttgtcacc
caggtagtcgccgcgccgttttcgattatatacggaaaactggcagaacgcttcacgggg
aagaccatgctgtacgtcgggatcgtcatttatatgatcgtctgcgtgtatgcctatttt
atggagacaacgcttgatttctggatactggctatgcttgtcgccacctcgcaaggcggt
attcaagccctaagccgttcctatttcgccaagcttgtgccaaagcgccacgccaatgaa
ttctttggcttctacaacatttttggaaaattcgcctcaattatggggccgctgctcatt
gccgttaccgcccagctgaccggtaaatcctcgactgcggtgttcagcctgatcattttg
tttgtgattggtattgtgattcttgcctttgttcccgaggaaaccagcacagatgtcagc
cagcagcaaaatgacctgcccctttaa

DBGET integrated database retrieval system