KEGG   Bacillus subtilis subsp. subtilis 168: BSU39120
Entry
BSU39120          CDS       T00010                                 

Symbol
yxiM
Name
(RefSeq) esterase YxiM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Other DBs
NCBI-GeneID: 937485
NCBI-ProteinID: NP_391791
Pasteur: BG11142
BSORF: BG11142
UniProt: P42304 A0A6M3ZLQ4
Structure
PDB: 
2O14

Position
complement(4017508..4018656)
AA seq 382 aa
MKKWMAAVFVMMLMLCFGGIENVKAAEPKVYQFDFGSGSMEPGYIGVRASDRYDRSKGYG
FQTPENMRDVAASGAGVKSDAVQFLAYGTKSNNTFNVDLPNGLYEVKVTLGNTARASVAA
EGVFQVINMTGDGAEDTFQIPVTDGQLNLLVTEGKAGTAFTLSALKIKKLSDQPVTNRTI
YVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAIL
KYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFT
SEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNR
AGADALARLAVQELKRQGIAGF
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaaaaatggatggcagcggtttttgtgatgatgctgatgctgtgttttggcgggatt
gagaatgtgaaggcggcggagccgaaggtgtatcagtttgactttggaagcggttcgatg
gagcctggttatattggtgtcagggcgtctgatcggtatgaccggtcaaagggctacggt
tttcaaacaccggagaatatgagggatgtggcggcatccggggctggtgtgaagagtgat
gcggttcagtttttagcgtatgggacgaaaagcaataacacgtttaatgttgatctcccg
aatggcctttatgaggtgaaggtgacgcttggcaatacggcaagggccagtgtggcagcg
gagggcgtgtttcaggtcatcaatatgacaggggatggcgcggaggatacgttccaaatt
cccgtcaccgacgggcagctgaatctgctggtgacagagggaaaggcaggcaccgctttt
acgctcagcgccttgaaaataaagaaattgtctgatcagccggtaacgaatcgaaccatt
tatgtcggcggcgactcgacggtgtgcaattattatccgctcaacagcagcaagcaggcg
ggctgggggcagatgctgcctcactatatcgataaacacacctttcaagtgagaaacatg
gcgtctggcgggcagatcgcgagagggttcagaaatgatggacagcttgaggcgattctg
aagtatattaaacccggagattattttatgttgcagcttggcattaatgacacaaatccg
aagcataaagaatctgaagcggagtttaaagaggtgatgcgtgatatgattcgtcaggta
aaagcgaaaggagcggacgtcatcctatcaacgcctcagggccgggcaaccgattttact
tctgaaggcatccattcgtctgtaaacagatggtacagggcctctattttagctttggcc
gaagaggaaaaaacatatctcattgacttaaatgtcctcagctcggcatactttacatcg
atcggtccggaaagaacactcgggctttatatggatggagatacgctgcacccgaatcgc
gcgggggccgacgcactggcgcgattggctgttcaggagctaaaacgccagggaatcgct
ggcttttaa

DBGET integrated database retrieval system