KEGG   Bacillus subtilis subsp. subtilis 168: BSU39139
Entry
BSU39139          CDS       T00010                                 

Symbol
yxzJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303069
NCBI-ProteinID: YP_003097796
UniProt: C0H3T5 A0A6M3ZIP6
Position
complement(4019005..4019136)
AA seq 43 aa
MNITQYEKLKQHLSDEDTGPFTLNEFSFYMKEDDRYIHIPVFE
NT seq 132 nt   +upstreamnt  +downstreamnt
ttgaatatcacacaatacgagaaattgaaacagcatctttctgatgaggatacaggtcca
tttacattaaacgagttttctttctatatgaaagaagatgatcgttatattcatattcct
gtgtttgaatga

DBGET integrated database retrieval system