KEGG   Bacillus subtilis subsp. subtilis 168: BSU39140
Entry
BSU39140          CDS       T00010                                 

Gene name
yxiK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937483
NCBI-ProteinID: NP_391793
Pasteur: BG11140
BSORF: BG11140
UniProt: P42302 A0A6M4JQN2
Position
complement(4019148..4019609)
AA seq 153 aa
MEITSISSIGNLDMIELKPDQTVMACELEDAESFYRFWAGLAYDRIMIQVITTGSFIEDL
SEYFEGHAYKVTKLAKREFHFQSILQEADRDIADFLFLLASINDDVFLITDPQPDKSYFS
EGKLQCLTDSGERIIWFEYDAVDIYMIGGESYK
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaataacctctataagcagtattggcaatttggacatgatcgagcttaagcctgac
caaaccgttatggcatgcgaacttgaagatgcagagtcgttttatcgtttttgggcaggg
cttgcctacgatcgaatcatgatacaggtaataacgactggttcatttatagaagacctg
tccgagtattttgaaggtcatgcttacaaggtgacgaagctggccaaaagggaattccat
ttccaatccatattacaggaagcagaccgggatattgcagattttctctttctgctagct
tccatcaatgatgatgtttttctgatcactgatcctcaaccggataaaagctatttttca
gaagggaagctccaatgcctaacggactcaggcgaacggatcatatggtttgaatacgat
gctgtggacatttatatgattggcggtgaatcatataaatag

DBGET integrated database retrieval system