KEGG   Bacillus subtilis subsp. subtilis 168: BSU39150
Entry
BSU39150          CDS       T00010                                 

Symbol
yxiJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YxiJ
Other DBs
NCBI-GeneID: 937504
NCBI-ProteinID: NP_391794
Pasteur: BG11139
BSORF: BG11139
UniProt: P42320 A0A6M3ZHX6
Position
complement(4019625..4019921)
AA seq 98 aa
MLQKLRKRQRELEEKQYPDELYGFEAEIYEFFMLVAGSLDYVLANKRIPRHQRRSLEKSF
FELYPDILPDMIKNDKDLYHHILLYEQVRQEICVALSN
NT seq 297 nt   +upstreamnt  +downstreamnt
gtgcttcaaaaactgagaaaaagacagcgagagcttgaagaaaagcagtaccctgatgaa
ttgtacggctttgaagcggaaatctatgagttttttatgcttgttgctggcagtttggat
tatgtgctggcgaataaaaggataccccggcatcagcggcgttcgttggagaaaagcttt
tttgagctgtatcctgacatacttccggatatgatcaaaaacgataaggatctgtatcat
cacattctcttgtatgaacaagtcagacaagagatttgcgttgcgctatccaactga

DBGET integrated database retrieval system