KEGG   Bacillus subtilis subsp. subtilis 168: BSU39160
Entry
BSU39160          CDS       T00010                                 

Symbol
yxiI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2716 DUF1176
Other DBs
NCBI-GeneID: 937495
NCBI-ProteinID: NP_391795
Pasteur: BG11138
BSORF: BG11138
UniProt: P42301 A0A6M3ZI20
Position
complement(4019949..4020437)
AA seq 162 aa
MMNWRALSQTKQDRIWSEVNKIIKWKPGSRCHHIIPPDPYRVFDISSAMSSKAGHNDVSG
VLSDLETSILKAFQLGTGKNDVMYALDWQHDGYTFSPHQAMPKDEFGEWPVPVFPNGDYY
FFFHQDFSWGLLGDPWKCAITVFGEELLEAIDNDPPILFRNK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgatgaattggcgcgctttaagtcagacaaaacaagaccgcatctggtcagaagtgaac
aagatcataaaatggaagcccggaagcagatgtcatcacatcatcccgcctgatccatat
cgagtgtttgatatctcaagcgcgatgagcagtaaagctggtcataatgatgtgagcgga
gtgctaagtgatttagagacttctattttaaaagcatttcaattaggtactggaaagaac
gatgtaatgtacgcactagattggcagcatgacggatatacctttagtcctcatcaggca
atgcctaaggatgaatttggcgaatggcctgttcccgtatttccaaatggagactattat
ttcttttttcatcaggacttctcctggggacttttgggagacccgtggaaatgtgcaatc
actgtgtttggtgaagagctgttggaggcgatagataatgatccgcctattctgtttcga
aataaatga

DBGET integrated database retrieval system