KEGG   Bacillus subtilis subsp. subtilis 168: BSU39190
Entry
BSU39190          CDS       T00010                                 

Gene name
yxiG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GCP_C_terminal
Other DBs
NCBI-GeneID: 937774
NCBI-ProteinID: NP_391798
Pasteur: BG11136
BSORF: BG11136
UniProt: P42299 A0A6M3ZHT8
Position
complement(4021429..4021845)
AA seq 138 aa
MTMYQTINEWVDYIDKGCSVLHLDFNVFKKELSLDIKVFEDEGEYTHKISFQNVASAYYS
ADVGDMRLEKIDPEEYNWQVFEMSYHPEGIGNLSNSIIPEYQSNANFLIDMNRMLIAIEA
ETVRFDDQSFYAYQLNTK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgacaatgtatcaaacgattaatgaatgggttgattatatagataaggggtgcagtgtc
cttcatttagattttaatgtgtttaaaaaagaactctcacttgatattaaggtttttgaa
gatgaaggtgaatatacgcataaaatttcatttcaaaatgtggcatccgcttattatagt
gcagatgttggcgacatgagattggaaaaaatagatccggaagaatacaattggcaagta
tttgagatgagttatcatccagaaggaatcgggaatctatcaaattctataattccggag
tatcaatcaaatgctaactttcttattgacatgaacagaatgctgattgctatagaagct
gaaacagttcgctttgatgatcaatcgttttatgcataccaattaaacactaaatga

DBGET integrated database retrieval system