KEGG   Bacillus subtilis subsp. subtilis 168: BSU39210Help
Entry
BSU39210          CDS       T00010                                 

Gene name
yxiF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 937519
NCBI-ProteinID: NP_391800
Pasteur: BG11135
BSORF: BG11135
UniProt: P42298
Position
complement(4022258..4022728)
Genome map
AA seq 156 aa AA seqDB search
MQKRLIEKLAENKRRLLMSEIKEKLVPCAERGFTYRFADLAQSRQLLELVLSNSIPANTR
EVDALEKTEAKQLIWKISQSYVAYDDRDVLLFHQYSSEIGALVCSFGKCLEHLDCLLECI
EFDEGILNHSFILVEPKCQFGLCILHTEYGCELVYW
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaagattgatcgaaaaactcgccgagaataaaagacgtttattgatgagcgaa
atcaaagaaaaactagtcccttgtgcagaaagaggcttcacttatcgttttgctgatctg
gcgcaaagcaggcaattgcttgagctggttttatcaaattcaataccagccaacacccgt
gaggttgatgccctcgaaaaaacggaagcgaaacagctgatctggaaaatatctcagtca
tatgttgcttacgatgaccgggacgttctgctgtttcatcaatacagcagcgaaattggt
gcgttagtttgttcttttggaaaatgtctcgagcaccttgactgcttattggagtgtatt
gagttcgatgaagggattctcaatcatagttttattttggttgagcctaagtgccagttt
ggtttatgtatattgcacacggaatacggatgtgagcttgtttattggtag

DBGET integrated database retrieval system