KEGG   Bacillus subtilis subsp. subtilis 168: BSU39240
Entry
BSU39240          CDS       T00010                                 

Gene name
yxxF
Definition
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EamA TPT DUF1435
Other DBs
NCBI-GeneID: 937510
NCBI-ProteinID: NP_391803
Pasteur: BG10796
BSORF: BG10796
UniProt: Q07835 A0A6M3ZJS0
Position
complement(4030710..4031645)
AA seq 311 aa
MQQDPSISSKQKSTAVIKMVISMVIFGSIGFFSEHTNLPSFELVFVRCLCATLFLGFCWL
ASGQYKTEKWSKRDVLQTLACGFFLVFNWVFLFKSFEETSVTIAISVYHLAPVLVLLLGS
FFYREKLNVISVSSIIICFLGTALISGINGSTSLTQLMGSGIIWAVLAALFYAFTTLLGK
GIHNLSPYTTTFLQTGLGVIILIPFIHFGAFADLSQGNWIMVVSTGIIHTGIVYLLFFDS
LRFLSTKFISIIVFLDPAVAIVLDTVFTGFRPDLYQTLGIVMIFAGMALTLVRRQGKANV
TAEGTDIEQIQ
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcaacaggatccttccatatcgtcaaaacaaaaatcaacagccgtaatcaaaatggtc
atctctatggtgattttcggctccatcggctttttctcagagcataccaatctgccgtca
tttgaattggtctttgtccgctgcctttgcgcgacgctgtttttaggcttttgctggctg
gcgtccggccagtataaaactgaaaaatggagcaagagagacgtgctgcaaacattggcg
tgcggtttctttcttgtattcaactgggtgttcttatttaagtcttttgaagaaacgtcc
gttacaattgccatctctgtttatcatctagcgccggtgcttgttcttcttctggggagc
ttcttctacagagagaaattaaatgtgatctccgtcagctccattatcatctgctttctt
gggactgcgctgatttccgggattaacggcagcacatcattgacacagctgatgggatca
gggatcatatgggcagttctcgccgcactgttttatgcgttcaccactttattgggaaaa
ggcattcacaatctcagtccttacacgaccaccttcttgcagacaggtttaggggttatc
atcctgattccgtttattcactttggcgcttttgcggacctatctcagggaaactggatt
atggtggtatctaccggcatcatccatacgggtattgtatatttgctgttttttgacagt
ttacgatttttatcaacgaaatttatttcaatcattgtatttctcgaccccgctgtcgcg
atcgtgctcgataccgtcttcacaggcttccgccctgacctctatcaaacgcttggcatc
gtaatgatctttgcgggcatggccttgacgcttgtcaggaggcaggggaaggcgaatgtg
acagctgagggtacggatattgaacaaatacaataa

DBGET integrated database retrieval system