KEGG   Bacillus subtilis subsp. subtilis 168: BSU39250
Entry
BSU39250          CDS       T00010                                 

Gene name
yxiE
Definition
(RefSeq) universal stress protein YxiE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Usp Porin_5 DAGK_cat DUF1173 DUF5603 IF3_C DUF3335
Other DBs
NCBI-GeneID: 937971
NCBI-ProteinID: NP_391804
Pasteur: BG11134
BSORF: BG11134
UniProt: P42297 A0A6M3ZHM1
Position
complement(4031797..4032243)
AA seq 148 aa
MFNKMLVAIDGSDMSAKALDAAVHLAKEQQAELSILHVGREAVVTTSSLTGIVYVPEHFI
DEIRNEVKKEGLKILENAKEKAAEKGVQAETIYANGEPAHEILNHAKEKGVSLIVVGSRG
ISGLKEMMLGSVSHKVSQLSTCPVLIVR
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtttaacaaaatgttagtagcgattgacggatcagacatgagtgcaaaagcgcttgat
gccgcagtgcatttggcaaaagagcaacaagcggaactaagcattcttcatgtggggaga
gaagccgtcgtcacgacttcttctctgacgggaattgtctatgtgcctgaacactttatt
gatgaaatcaggaacgaggttaaaaaagagggcctgaaaatccttgagaatgcaaaagaa
aaagcagccgaaaaaggcgttcaagctgaaaccatttacgcgaatggcgagccggcgcat
gagatactaaatcacgcaaaagagaaaggcgtcagcctgattgtagttggcagccggggg
atcagcggcctgaaagaaatgatgcttggaagcgtcagccataaagtgtctcaattatca
acatgcccggttttgattgttcgatag

DBGET integrated database retrieval system