KEGG   Bacillus subtilis subsp. subtilis 168: BSU39280
Entry
BSU39280          CDS       T00010                                 

Gene name
yxxE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: CdiI_2
Other DBs
NCBI-GeneID: 937520
NCBI-ProteinID: NP_391807
Pasteur: BG11071
BSORF: BG11071
UniProt: P40738 A0A6M4JQS5
Position
complement(4035990..4036298)
AA seq 102 aa
MLLINKQKDPVFQFLAGTFHQDIETPDDAIQELLIEESKEYLEDAIVFLTDFIESEHSDN
KKNDYIQSCADGVYLPAFNLEPIDWLKNVIVQIKKSLKKFKR
NT seq 309 nt   +upstreamnt  +downstreamnt
atgttattgatcaataaacagaaggaccctgtttttcagtttttagctggaacattccat
caagatattgaaactcctgatgacgctatacaagagttattaatagaggaaagtaaggaa
tatttggaggatgctattgtctttttaacggattttattgaaagtgagcattcagacaat
aagaaaaacgattacattcaatcttgcgcagatggcgtgtatcttcctgcgtttaattta
gaaccaatagattggctaaagaatgtaatagtacagataaagaagtctttaaaaaaattt
aaacggtaa

DBGET integrated database retrieval system