KEGG   Bacillus subtilis subsp. subtilis 168: BSU39300
Entry
BSU39300          CDS       T00010                                 

Gene name
yxiD
Definition
(RefSeq) hypothetical protein
  KO
K21493  toxin YxiD [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU39300 (yxiD)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU39300 (yxiD)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   YxiD-YxxD
    BSU39300 (yxiD)
SSDB
Motif
Pfam: LXG PT-TG DUF3284 DUF4164
Other DBs
NCBI-GeneID: 937523
NCBI-ProteinID: NP_391809
Pasteur: BG11133
BSORF: BG11133
UniProt: P42296 A0A6M3ZHU5
Position
complement(4036784..4038493)
AA seq 569 aa
MKTLDVHALHEGIQHTIEKLDKQKQQLEKLEKSVEHLAGMKDALKGKGGDAIRTFYEECH
KPFLLFFGIFIDEYKKVLKQTQHAISSVESNSHGMIAEAFLSHDARHGVKHAREVTEQLT
DAVNRQTSAIDHIVSLPTVNDSFFRMETEQAERLISDTLNKLFQFDGQQTQALEAAKSDF
QTMKKYIDQLETMYTGPKIEITGYKSGSILKSQEEENINQIFGAINPQMKQADDSPMEMM
LKKLAENEKSKVDSVVKTGDSKKVSKNIIVINGKVYNTSEHREHIKTDFSNAEVKQVVYN
DTLYNVYISGNDMKLEPVVSLSDIKVDENGYVKILETAVELTGVYDLFKAATGRDPVSGE
KVTGKDRVVASINSVPFAKIAKLEKLIDINKLINNGKKAKKASEVKNVAKDKGKIANDVS
GSANKINSDLIKKYARDIEQRTGRELPKNQIDKLKEALRNKEYKKMSPIETAKHRTKFDK
VKNKVIKEWEENTGQKWPVYKENVVSEKTGKIIRKKGDKYDAHHIIENTFGGEHEWWNMH
PAKFPNEHQAGIHGTGSPANELFKGGKKK
NT seq 1710 nt   +upstreamnt  +downstreamnt
ttgaaaacattagatgtccacgctcttcacgagggcattcagcatacgattgagaaactg
gacaagcaaaaacaacagctggagaagctggaaaaaagcgttgagcatctggcaggcatg
aaggatgcgctgaaaggaaaaggcggagatgccatccggaccttttacgaggagtgccac
aagccttttctccttttctttggcatatttatcgacgaatacaaaaaagtgctgaaacaa
acacagcatgcgatttcctctgtagaatctaactcccacggcatgatcgcagaggctttt
ctctcacacgatgcgagacatggggtcaagcatgcacgagaagtgacagagcagctcact
gacgcagtcaatcgccagacatcagccatagatcacatcgtcagcctgccgacagtcaat
gattccttttttcggatggaaacagaacaggctgagcggctgatttcagacaccctgaat
aagctctttcaatttgacggccagcaaacccaagcactagaagccgcaaaatcagatttt
caaacgatgaaaaaatacattgatcagctcgaaaccatgtacaccggcccgaaaattgaa
atcacaggctacaaaagcggctccatcctgaaatcacaggaagaagaaaacatcaaccaa
atcttcggcgcgattaacccgcaaatgaagcaggcggatgattcaccgatggagatgatg
ctgaagaaattagccgagaatgaaaagtctaaagtggattcagttgtcaaaacgggtgat
tctaaaaaggtaagtaaaaatatcatcgttatcaatggtaaagtgtataatacgagtgaa
catagagaacatataaaaactgatttctcaaatgcagaggttaagcaagtcgtttataat
gatacactttacaatgtatacatatctggtaatgacatgaagcttgaacctgtcgtctcg
ctttcggacattaaagtggatgagaatggatatgtgaaaattttagagacggctgtagaa
cttaccggcgtgtatgatctatttaaagcagccacgggcagagatccggtatcaggcgaa
aaagtcacagggaaagaccgtgttgttgcctccataaactcagtaccatttgccaaaata
gctaagttagaaaagttaatagatattaataaacttattaataatgggaaaaaggctaag
aaggcttcggaagttaaaaacgttgctaaggataaagggaaaattgcgaatgatgtaagt
ggatctgctaataaaattaattctgatttaataaaaaagtatgctagagatatagaacaa
cgcacaggtagagaattacctaaaaatcaaatagataaattaaaggaagcattaagaaat
aaagaatataaaaaaatgtcaccaatagagactgcaaaacacaggactaaatttgataaa
gtaaaaaataaagttataaaagaatgggaagaaaacactggacaaaaatggcctgtttat
aaggaaaatgttgtatctgaaaaaacaggtaaaattattagaaaaaaaggggataagtat
gatgctcaccatataattgaaaatacttttggcggagaacatgaatggtggaatatgcat
ccagcaaaatttcctaacgagcatcaagctgggattcatggtacaggctcaccagcaaat
gaattatttaaaggaggcaaaaaaaaatga

DBGET integrated database retrieval system