KEGG   Bacillus subtilis subsp. subtilis 168: BSU39339
Entry
BSU39339          CDS       T00010                                 

Symbol
yxzL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: K-box
Other DBs
NCBI-GeneID: 8302942
NCBI-ProteinID: YP_003097797
UniProt: C0H3T6 A0A6M3ZIS4
Position
complement(4041009..4041173)
AA seq 54 aa
MAVSQLMQNLTKQLLHVRERKTDVMQEGETAKELNYEGEDMQATSSAQNRQTSV
NT seq 165 nt   +upstreamnt  +downstreamnt
atggctgtatcacagttgatgcaaaacctgacaaagcagttattacatgtacgcgaaaga
aaaacagacgtgatgcaagaaggagaaacagcaaaagagttgaactatgaaggagaggat
atgcaagcaacaagttctgcgcaaaacagacagacatcagtctga

DBGET integrated database retrieval system