KEGG   Bacillus subtilis subsp. subtilis 168: BSU39350
Entry
BSU39350          CDS       T00010                                 

Gene name
hutH
Definition
(RefSeq) histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00340  Histidine metabolism
bsu01100  Metabolic pathways
Module
bsu_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BSU39350 (hutH)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     BSU39350 (hutH)
SSDB
Motif
Pfam: Lyase_aromatic
Other DBs
NCBI-GeneID: 937541
NCBI-ProteinID: NP_391814
Pasteur: BG10667
BSORF: BG10667
UniProt: P10944
Position
4042051..4043577
AA seq 508 aa
MVTLDGSSLTTADVARVLFDFEEAAASEESMERVKKSRAAVERIVRDEKTIYGINTGFGK
FSDVLIQKEDSAALQLNLILSHACGVGDPFPECVSRAMLLLRANALLKGFSGVRAELIEQ
LLAFLNKRVHPVIPQQGSLGASGDLAPLSHLALALIGQGEVFFEGERMPAMTGLKKAGIQ
PVTLTSKEGLALINGTQAMTAMGVVAYIEAEKLAYQTERIASLTIEGLQGIIDAFDEDIH
LARGYQEQIDVAERIRFYLSDSGLTTSQGELRVQDAYSLRCIPQVHGATWQTLGYVKEKL
EIEMNAATDNPLIFNDGDKVISGGNFHGQPIAFAMDFLKIAISELANIAERRIERLVNPQ
LNDLPPFLSPHPGLQSGAMIMQYAAASLVSENKTLAHPASVDSIPSSANQEDHVSMGTIA
ARHAYQVIANTRRVIAIEAICALQAVEYRGIEHAASYTKQLFQEMRKVVPSIQQDRVFSY
DIERLTDWLKKESLIPDHQNKELRGMNI
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggtgactttagacggttcttcattgacaacagccgacgtcgctcgtgtgctgtttgat
tttgaggaggcagcggcttctgaggaaagtatggagcgcgtgaaaaaaagcagagcagca
gtggaacggattgtacgcgacgaaaagacaatctacggcatcaacaccggatttggcaaa
ttcagcgatgtcctgattcagaaagaagactcggcggcgctgcagctgaatttaatcctt
tctcatgcctgcggagtcggcgacccttttcctgagtgtgtttccagggcaatgctgctt
ttgcgcgccaatgcgctgttaaaaggcttttccggtgtacgcgctgagctgatcgagcag
ttgcttgcttttttaaataaacgcgtccatcctgtcatccctcagcaaggatcacttggc
gcaagcggagatctggcgccgctttcccacttggcgcttgcgctgatcggacaaggagaa
gtcttttttgagggggaaagaatgccggcaatgacaggcttgaaaaaagcaggtattcaa
ccggtaacgctgacatccaaggaagggcttgccttgattaacgggactcaggccatgact
gcaatgggggtggtcgcctacatcgaagctgagaaactagcctatcaaacagaacgaatt
gccagcttaacgattgaggggttgcagggaattatcgatgcatttgacgaggatattcac
ttagcccgcggctatcaggagcagatcgatgtcgcagaacgaattcgcttttatctatct
gacagcggcctgacaacctcccagggagaactgcgggtacaggatgcctattcattgcgc
tgtattccgcaagtacacggtgcgacttggcagacactaggatatgtcaaagaaaaatta
gagattgaaatgaacgcagctacagacaatccactcattttcaatgacggtgacaaagtg
atttccggcggaaactttcacggacagccaatcgcctttgccatggattttctgaaaatc
gcaatatcagagcttgcgaatatcgcagagcgtaggatcgaacgacttgtgaatccgcag
ctgaatgacctgccgccgttcctgagccctcatcccggtctgcaatccggtgcaatgatc
atgcagtacgccgcggcctcactcgtttctgaaaataaaacactggcccatcctgcaagt
gtggattccattccgtcatccgccaaccaagaggaccatgtcagcatgggaaccatcgcc
gctcggcatgcttatcaggtgatcgcaaatacaaggagagtcattgcgatcgaagccatt
tgcgcattgcaggctgttgaatacagaggcatagaacatgcagcgtcctatacgaaacag
ctttttcaagaaatgagaaaagtcgtgccgtccattcagcaggaccgtgttttttcctat
gacattgaacgcttgactgactggctgaagaaagaatctttaatacctgatcatcagaat
aaagaactaagggggatgaacatatga

DBGET integrated database retrieval system