KEGG   Bacillus subtilis subsp. subtilis 168: BSU39390
Entry
BSU39390          CDS       T00010                                 

Symbol
hutM
Name
(RefSeq) histidine permease
  KO
K16236  histidine permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39390 (hutM)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU39390 (hutM)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 938565
NCBI-ProteinID: NP_391818
Pasteur: BG11101
BSORF: BG11101
UniProt: P42087 A0A6M3ZHX3
Position
4047538..4048965
AA seq 475 aa
MNLQENSSQQLKRTMKSRHLFMISLGGVIGTGLFLSTGYTLHQAGPGGTILAYVIGGLMM
YLVMQCLGELSVAMPVTGSFQKYATTFIGPSTGFMVGIMYWINWVVTVGSEFTASGILMQ
RWFPDSSVWMWSAIFAALLFICNAFSVKLFAETEFWFSSVKIVTIILFIILGGAAMFGLI
SLNGTADAPMLSNFTDHGGLFPNGFLAVFIAMISVSFAFSGTELIGVTAGESANPQKDIP
RSIRNVAWRTVIFFIGAVFILSGLISWKDAGVIESPFVAVFAEIGIPYAADIMNFVILTA
LLSVANSGLYASTRMMWSLANENMISSRFKKVTSKGIPLNALMISMAVSCLSLVSSIVAP
GTVYVVMVAIAGFAGVVVWMSIALSQLLFRKRFLKKGGDVKDLTFRTPLYPLMPIAALLL
CSASCIGLAFDPNQRIALFCGVPCIILCYLIYHFKRNVTKAKKISQEEYPADHIL
NT seq 1428 nt   +upstreamnt  +downstreamnt
gtgaatcttcaggagaacagcagccaacagctaaaacgcacaatgaaaagcaggcaccta
tttatgatctcattgggaggcgtcataggcacaggacttttcctcagtacgggctatacg
ctacatcaagccggacccggcggtacgatactcgcttatgtaatcggcgggttgatgatg
tacctcgtcatgcaatgtctcggcgaattgtcggttgccatgccggtgaccggctctttt
caaaaatatgctacaacatttatcggtccatctaccggttttatggtcggcatcatgtac
tggatcaattgggtggtgacggtaggctctgagtttaccgcatccggtattctcatgcag
cgctggttccctgacagcagtgtatggatgtggagtgcgatttttgcagcccttcttttt
atatgcaacgcattttcagttaagttatttgcggaaactgaattttggttttccagcgta
aagattgtcaccattattttatttatcattttaggaggagccgccatgtttggcctgatc
tctttaaacggaacggcggatgctcctatgttgtcaaacttcacagatcatggcgggttg
tttccaaatggctttctcgccgtttttatcgcgatgatatctgtgagcttcgccttttcc
ggtacagagttaatcggcgttacagcaggagaatcagcaaatcctcaaaaggatataccg
cgatccatccgtaatgtcgcatggagaaccgtgatttttttcattggcgctgtcttcata
ttatccgggttgatttcatggaaggacgcaggcgtgattgaaagcccgtttgtcgccgta
tttgcggagatcggaattccttacgctgctgatattatgaatttcgtaatattaacagcc
ttgctgtctgtcgccaactcaggcttatatgcttcgacccgtatgatgtggtctttagca
aatgaaaacatgatcagctcccgttttaagaaagtgacatctaaaggcattcctttaaat
gccttaatgatcagtatggctgtatcttgtttatctctcgtttccagtatcgtggcccct
ggaactgtctatgtggtgatggtcgcaattgctggatttgcaggagtcgtggtctggatg
agcattgccttgtcccaactcttgtttcgaaagagatttttgaaaaaagggggggatgta
aaagatctgacatttcgcacgccgctttatcctcttatgcctatagccgctctcttatta
tgttctgcttcttgtatcggtcttgcttttgatcccaatcaaagaatcgcacttttctgc
ggagttccttgtatcatcctttgctatctcatctaccatttcaaaagaaatgttacaaaa
gcgaaaaaaatcagccaagaggaatatccagccgatcacatcctataa

DBGET integrated database retrieval system