KEGG   Bacillus subtilis subsp. subtilis 168: BSU39410
Entry
BSU39410          CDS       T00010                                 

Symbol
nupC
Name
(RefSeq) pyrimidine nucleoside transport protein
  KO
K11535  nucleoside transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39410 (nupC)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU39410 (nupC)
SSDB
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate
Other DBs
NCBI-GeneID: 937534
NCBI-ProteinID: NP_391820
Pasteur: BG10984
BSORF: BG10984
UniProt: P39141 A0A6M4JQT5
Position
complement(4050340..4051521)
AA seq 393 aa
MKYLIGIIGLIVFLGLAWIASSGKKRIKIRPIVVMLILQFILGYILLNTGIGNFLVGGFA
KGFGYLLEYAAEGINFVFGGLVNADQTTFFMNVLLPIVFISALIGILQKWKVLPFIIRYI
GLALSKVNGMGRLESYNAVASAILGQSEVFISLKKELGLLNQQRLYTLCASAMSTVSMSI
VGAYMTMLKPEYVVTALVLNLFGGFIIASIINPYEVAKEEDMLRVEEEEKQSFFEVLGEY
ILDGFKVAVVVAAMLIGFVAIIALINGIFNAVFGISFQGILGYVFAPFAFLVGIPWNEAV
NAGSIMATKMVSNEFVAMTSLTQNGFHFSGRTTAIVSVFLVSFANFSSIGIIAGAVKGLN
EKQGNVVARFGLKLLYGATLVSFLSAAIVGLIY
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgaagtatttgattgggattatcggtttaatcgtgtttttaggcctcgcgtggatcgcg
agcagcggcaaaaaaagaattaagatccgcccaattgttgttatgctcattttgcaattt
attcttggctacattctcctcaataccggaatagggaatttcctcgtgggaggatttgca
aaaggattcggttacctgcttgaatacgcggcagagggaattaactttgtgtttggcggc
ttggtgaatgcggaccaaacgacattctttatgaatgttctcttgccaatcgtgtttatt
tccgctctgatcgggattctgcaaaagtggaaagtcctcccgtttatcattagatatatc
ggccttgccctcagcaaggtaaacggtatgggaagattggaatcgtataacgcagtggct
tctgcgattttagggcagtcagaagtatttatctccttgaagaaagaactcggtctttta
aatcagcagcgcttgtacacgctttgcgcatctgcgatgtcaactgtatcaatgtcgatt
gtcggtgcgtatatgacaatgctgaaaccggaatatgttgtaacagcgcttgttttgaac
ttatttggcggtttcattatcgcttctattatcaatccgtacgaggttgcaaaagaagag
gatatgcttcgtgttgaggaagaagaaaaacaatccttcttcgaagtgctcggagaatac
attcttgacggtttcaaagtagcggttgtcgtcgctgcgatgctgattggatttgtcgcg
attattgcattgatcaatggcatttttaatgcagtattcggtatttcgttccaaggcatt
cttggatatgtgtttgctccattcgcttttcttgtcggtatcccatggaatgaagctgtt
aatgcgggaagcattatggcaacaaaaatggtatcgaatgaatttgtcgccatgacgtcg
cttacgcaaaacggtttccatttcagcggccgtacaacagcgatcgtatcggtattcctt
gtgtcatttgcgaacttctcctcaatcggaatcattgccggtgccgtaaaaggactgaat
gaaaagcaaggaaatgtcgtcgctcgtttcggcttgaaattattatacggtgctacgctt
gtcagctttttatcagcagcaattgtgggcttgatttactga

DBGET integrated database retrieval system