KEGG   Bacillus subtilis subsp. subtilis 168: BSU39420
Entry
BSU39420          CDS       T00010                                 

Symbol
deoC
Name
(RefSeq) 2-deoxyribose-5-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU39420 (deoC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     BSU39420 (deoC)
SSDB
Motif
Pfam: DeoC Sulfotransfer_5 DHO_dh
Other DBs
NCBI-GeneID: 938608
NCBI-ProteinID: NP_391821
Pasteur: BG10983
BSORF: BG10983
UniProt: P39121 A0A6M3ZLR8
Position
complement(4051602..4052273)
AA seq 223 aa
MSLANIIDHTALKPHTQKADILKLIEEAKTYKFASVCVNPTWVELAAKELKGTGVDVCTV
IGFPLGANTTETKAFETKDAISKGATEVDMVINIAALKDKEDDVVEADIRGVVEAVAGKA
LVKVIIETCLLTDEEKERACRLAVSAGADFVKTSTGFSTGGATKEDIALMRKTVGPDIGV
KASGGVRTKEDVDTMVEAGASRIGASAGVSIVKGENASGGDNY
NT seq 672 nt   +upstreamnt  +downstreamnt
atgtcattagccaacataattgatcatacagctttgaaaccgcatacacaaaaagcggac
attctaaaactaattgaagaagcgaaaacatacaaatttgcttcagtatgtgtcaatccg
acatgggtggagcttgctgcaaaagagcttaagggaactggagtcgacgtttgtacggtc
atcggcttcccgctcggtgccaatacaactgaaacaaaagcgttcgaaacaaaagacgcc
atttcaaaaggcgccactgaagtggatatggtcattaatattgccgctttaaaagacaag
gaagacgatgtggtggaagctgatatccgcggtgtagtggaagctgtagccggaaaagcg
cttgtcaaagtcattatcgaaacgtgccttctgactgatgaagaaaaagaacgtgcatgc
cgtttagcggtgtctgcgggagcggatttcgtaaaaacatcaacaggcttttctacaggc
ggcgcaacgaaggaagatatcgccttaatgcgcaaaacagtagggcctgatatcggcgtg
aaagcatctggcggcgtcagaacgaaagaagatgtagacacaatggtagaggccggagca
agccgaattggcgccagcgcaggcgtttctatcgtaaaaggagaaaatgcatcaggcgga
gacaactattaa

DBGET integrated database retrieval system