KEGG   Bacillus subtilis subsp. subtilis 168: BSU39440
Entry
BSU39440          CDS       T00010                                 

Symbol
yxxB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1206 Phage_holin_3_6 L6_membrane
Other DBs
NCBI-GeneID: 937547
NCBI-ProteinID: NP_391823
Pasteur: BG10981
BSORF: BG10981
UniProt: P39139 A0A6M4JQS4
Position
complement(4053454..4054281)
AA seq 275 aa
MAVKDRYMSKIKQETKPWIKRFGRLGYFAFGGVFILLGVLAFMTAAGAGRAKDSSGALQT
LSRMPYGSLLLFFIGIGLIGYVIWMVLSAIKDTEGHGNSRRGLSRRIGNFFSAAVYTSIA
WNALRFVFGQGDGGTSEQTWSAYVLAQPFGQWLTGLTGAGFIVFAIVQFMKGVRAAFMKE
FDTSKMNKQMICITKNTGRAGNIARAIIFSAIGYFLIKTAMTADPDDTRGFDGALAELAQ
QPHGKLILSILALGLILYGMYAIMKGIYQHMTWEK
NT seq 828 nt   +upstreamnt  +downstreamnt
atggcggtgaaagaccggtacatgtcaaaaataaaacaggaaaccaagccttggatcaaa
cgattcgggaggcttggttattttgcattcggcggcgtttttattctgcttggggttttg
gcttttatgacggctgccggggcaggccgcgccaaagattcgagcggagctctccaaacg
ctatcacgcatgccgtatgggtcactattgcttttttttataggcatcggccttatcggc
tatgtgatctggatggtgttaagcgcgatcaaggacacggaggggcacggaaacagcagg
cgaggcctgtcgcggagaataggaaactttttcagtgccgctgtttacacatccatcgct
tggaatgccttgcgatttgtgtttggccaaggggacggcggcacttcagaacagacgtgg
tccgcttatgtattggcgcagccgttcggccaatggctcacagggcttacgggtgcgggt
tttatcgtatttgcgattgttcaatttatgaaaggcgttcgggctgcttttatgaaagaa
ttcgatacatcaaaaatgaacaaacagatgatatgcatcacgaaaaacacaggacgcgca
ggcaatatcgcccgggccattattttctcggctatcggctattttctcatcaagacagcc
atgaccgctgatcccgacgacacaagaggctttgacggcgcgctcgcagaactcgcgcag
cagccgcatggcaaattgattctgtctatattggcattaggcctgatcctatatggaatg
tacgccattatgaaaggcatttatcagcatatgacttgggagaagtaa

DBGET integrated database retrieval system