KEGG   Bacillus subtilis subsp. subtilis 168: BSU39450
Entry
BSU39450          CDS       T00010                                 

Symbol
yxeR
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EutH DUF5904
Other DBs
NCBI-GeneID: 937551
NCBI-ProteinID: NP_391824
Pasteur: BG11894
BSORF: BG11894
UniProt: P54957 A0A6M3ZI11
Position
complement(4054354..4055466)
AA seq 370 aa
MTVNDAVVFILAAFLLWGAADYCLGNRWGLGERFADGFKAMGPLALSMIGIVSLAPVLAA
ILIPIVAPFYTAIGADPSSFANTILAIDMGGYALAGEMAKDPQAGLFSWVFLGTMMGPAI
VFTIPVALGIIEKEDHPYFAKGILIGLCTVPIGCLIGGLCAGFDIGMIGKNLLIPSLLSA
VIAFGLWRYTDRMIQLFHLFGKAVSMVAIIGLAAVSVETMTGIVLIPGMENVETGIQTTG
TIAIALAGAFPMTAFITKTFKKPLQALGKCLHLDETATAGLVTSLAHHIPMLASLKDMTP
RGKVINVAFAVSGAFVLGSHLGFVAGMKKEMAAAMIIGKLAGGVTAAAAAAWMTPAQSAK
QQKRISASHS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgacggtgaatgacgcggttgtattcattttggctgcctttttactatggggagcagcg
gattattgtttgggaaacagatgggggctaggcgagcggtttgcggacggctttaaggct
atggggccgctggcgctgtccatgatcggaattgtatcgctggcgcccgtgctggcagca
atcttgattcccattgttgctccgttttacacagcgattggcgcggatccttcttccttt
gcgaacaccattttggcgattgatatgggaggatatgcgctggctggagaaatggcgaaa
gatccgcaggccgggctgttttcatgggtgtttttaggaacaatgatggggccggcaatc
gtcttcacgattcccgtcgctcttggcatcatcgaaaaagaggatcatccgtattttgcg
aaaggcatattaatcgggctgtgcacagtgccgatcggttgcttaatcggcggattatgc
gcaggctttgacatcggcatgataggtaaaaatcttctgatcccgagtctgttatctgct
gtcatcgcttttgggttatggcgatacaccgacagaatgattcagttgtttcatctcttc
gggaaagcggtcagtatggttgcgattatcgggcttgcagctgtttctgttgaaacgatg
accggcattgtgctgattccgggaatggagaatgtcgagacagggatacaaacgacaggg
accatcgccattgctctggcaggggcgttcccgatgacggcatttattacaaaaaccttt
aaaaaaccgcttcaggctctggggaaatgccttcatttagatgagacagcaacagcaggc
ttagtgacctctttggcgcatcatatcccaatgctggcttcattaaaggatatgacgccg
agaggaaaggtcatcaatgtcgcgtttgcggtcagcggcgcctttgtactcggcagccat
ctcggttttgtagctggaatgaaaaaagaaatggcggcggccatgatcattgggaaatta
gcaggcggagtcacagctgccgcagcggctgcttggatgacacctgcacaatcagctaaa
cagcaaaaacgtatctcagccagccatagctga

DBGET integrated database retrieval system