KEGG   Bacillus subtilis subsp. subtilis 168: BSU39460
Entry
BSU39460          CDS       T00010                                 

Symbol
yxeQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MmgE_PrpD MmgE_PrpD_C
Other DBs
NCBI-GeneID: 938528
NCBI-ProteinID: NP_391825
Pasteur: BG11893
BSORF: BG11893
UniProt: P54956 A0A6M3ZI44
Structure
Position
complement(4055536..4056873)
AA seq 445 aa
MSKQGLTAGLAEAVRTSQPEHSVDAIHEAKKGLLDFTAASFAGREDKGIQKLLRLIEDEG
GRPLVPVIGQGKKAAPLQSAMLNGFIAHALDFDDVHSDVRGHPSAVIVPALIASAARGHD
ERLLGAYVVGVEVMARLGESIGSRHYEKGWHNTGTLGAIAAACAVGYAEELTQEELEKAI
GFAATQSAGMRVQFGTEMKPLHAGLAAQAGLLAVKLAQSEFGGSRTALDGETGFFSLYGD
VEKAQHTLLNDWGAPWRIVQPGLWFKIYPFCSAAHHAADAVRQLISEETISAANTERIEV
IFPPGGDAALTERSPKAGEEGRFSVEYVIALALHGHGLTVEHFSSQPIPNGVQTTMGRIQ
RVYDNAIQPAPHAVPKGRFTIVRAYLSDGRICEARVDCPKGAPGNELSEEDIIEKLTLTV
PQEKARRIITAVEKADIKEFLAHIE
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgagcaaacaagggctgacagcaggtcttgcagaggctgtgagaacgtcacaacctgag
cattcagttgacgcgattcacgaagcaaaaaagggattacttgattttactgccgcttca
ttcgcaggaagagaagataaaggaattcaaaagctcctccgtctgatagaggatgaagga
ggccggccccttgttcctgttatcggacagggcaaaaaggccgcgccattacaatccgcg
atgctcaatggatttatcgcccatgcattggattttgatgatgtccactccgatgtaaga
ggacaccccagtgcagtcatcgtaccggcccttattgcttctgccgctcgcggacatgac
gagcggcttcttggcgcttatgttgttggtgttgaagtgatggcacggctgggagaatca
attggcagccgccactatgagaagggctggcataatacaggtacgcttggtgccatcgct
gctgcctgcgccgtaggttatgctgaggagctgactcaggaagagttggaaaaagcaatt
ggttttgcggctacgcaatctgctgggatgagggtgcaatttggaacagaaatgaaaccg
ctgcacgccggtttggcggctcaggctggcttgctggccgttaagctggcccaatcagaa
tttggcgggtcccgcacggcacttgatggagaaactggtttcttcagtctgtacggtgac
gttgagaaagcacaacacactttgctaaacgattggggggcaccgtggagaattgtgcag
ccgggtctatggtttaaaatctatccattttgttccgcggcacaccatgctgcagatgcg
gtacgacagcttatctccgaagaaaccatttctgctgccaataccgaacgtattgaagtg
atatttccgccaggcggagatgctgcattgacggaaagatctccaaaagctggagaggaa
ggccgtttcagcgttgaatatgtgattgctcttgctttgcatggacacggcctgaccgtt
gaacatttcagcagccagccgatcccaaacggggttcaaacgacaatggggcgaattcag
cgcgtatatgacaatgctattcagccggctcctcatgccgttccaaaaggccgtttcacg
attgtccgggcctatttatcagacggccggatttgcgaagcgcgtgtggactgcccaaaa
ggggcaccaggaaatgagctgtctgaagaagacataatagaaaaattgacattaacggtc
ccgcaagaaaaagcgcgacgcattataacagccgttgaaaaagccgatataaaagaattt
ttagctcatattgaataa

DBGET integrated database retrieval system