KEGG   Bacillus subtilis subsp. subtilis 168: BSU39470
Entry
BSU39470          CDS       T00010                                 

Symbol
yxeP
Name
(RefSeq) hydrolase YxeP
  KO
K21613  N-acetylcysteine deacetylase [EC:3.5.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU39470 (yxeP)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     BSU39470 (yxeP)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M20
   BSU39470 (yxeP)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer
Other DBs
NCBI-GeneID: 937572
NCBI-ProteinID: NP_391826
Pasteur: BG11892
BSORF: BG11892
UniProt: P54955 A0A6M3ZHR3
Structure
PDB: 
1YSJ

Position
complement(4056870..4058012)
AA seq 380 aa
MADKAFHTRLINMRRDLHEHPELSFQEVETTKKIRRWLEEEQIEILDVPQLKTGVIAEIK
GREDGPVIAIRADIDALPIQEQTNLPFASKVDGTMHACGHDFHTASIIGTAMLLNQRRAE
LKGTVRFIFQPAEEIAAGARKVLEAGVLNGVSAIFGMHNKPDLPVGTIGVKEGPLMASVD
RFEIVIKGKGGHAGIPNNSIDPIAAAGQIISGLQSVVSRNISSLQNAVVSITRVQAGTSW
NVIPDQAEMEGTVRTFQKEARQAVPEHMRRVAEGIAAGYGAQAEFKWFPYLPSVQNDGTF
LNAASEAAARLGYQTVHAEQSPGGEDFALYQEKIPGFFVWMGTNGTEEWHHPAFTLDEEA
LTVASQYFAELAVIVLETIK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggccgacaaagcgtttcatacccgtttaatcaatatgcggcgtgatcttcatgaacat
cctgaactgtcatttcaagaggttgaaacgacgaaaaaaatccgccgttggcttgaggag
gagcaaatcgaaatacttgatgtccctcaattgaagactggtgtgattgcagaaatcaaa
ggacgggaagacggccccgtgatagcaatacgagcggacattgacgcgctcccgatccaa
gaacagacgaatcttccatttgcatctaaggttgatggcacaatgcatgcgtgcggacac
gattttcatactgcttctattattggcacagcgatgttgctgaatcaaagaagggccgag
ctgaaaggtacagtccgctttatctttcagccggccgaagaaattgccgcaggagcaaga
aaggttctagaagctggcgtacttaatggcgtttctgcgattttcggcatgcacaataag
ccggatctgcctgtcgggaccattggtgtaaaggaaggtccgctcatggcaagtgttgac
cgatttgagatcgtcatcaaagggaaaggcgggcacgccggcatcccaaataacagtatt
gatccaatcgctgcagccggacaaatcatcagcgggctgcaatctgtggtcagccgcaat
atcagctcactgcaaaacgcagtcgtcagtatcacaagagtacaggcgggcacctcgtgg
aacgtaattccagaccaagctgaaatggaggggacggttcgaacctttcaaaaagaagcg
aggcaggctgttcccgagcatatgagacgagtggctgaaggaattgcagcgggctatggg
gcacaagcagaattcaagtggtttccttatttgccttccgttcagaatgacggcacattt
ttgaatgcggcatccgaagctgcggcacggcttggctatcaaaccgttcacgctgagcag
tctccgggcggagaagacttcgctctgtatcaagagaagattccgggattttttgtctgg
atgggaacgaacgggacggaggagtggcatcatccggcctttacactggatgaagaagcc
cttacggttgcctctcaatactttgcggagctggcggttattgtattggagaccatcaaa
tga

DBGET integrated database retrieval system