KEGG   Bacillus subtilis subsp. subtilis 168: BSU39480
Entry
BSU39480          CDS       T00010                                 

Gene name
yxeO
Definition
(RefSeq) amino acid import ATP-binding protein YxeO
  KO
K16963  putative S-methylcysteine transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU39480 (yxeO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39480 (yxeO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative S-methylcysteine transporter
    BSU39480 (yxeO)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_13 AAA_16 ABC_ATPase AAA_23 AAA_22 RsgA_GTPase AAA_33 AAA_19 AAA_15 DO-GTPase2 ATPase_2 AAA_30 Plant_NMP1 MMR_HSR1 DUF5040 AAA_28 NACHT AAA_24 G-alpha AAA_18 AAA_25 AAA_14 DUF3987 Rad17 DUF5906
Other DBs
NCBI-GeneID: 937555
NCBI-ProteinID: NP_391827
Pasteur: BG11891
BSORF: BG11891
UniProt: P54954 A0A6M4JQU2
Position
complement(4058029..4058778)
AA seq 249 aa
MITVKNIRKAFKDLVVLDGIDLEVKRGEVVAIIGPSGSGKSTLLRCLNLLERPDQGLIEI
GEAKLNAEKFTRKEAHRLRQQTAMVFQNYNLFKNKTALQNITEALIVAQHKPRDEAKRIG
MEILKQVGLEHKADSYPITMSGGQQQRIGIARALAVNPHAILLDEPTSALDPELVTGVLQ
VIKSIAEKQTTMIIVTHEMAFAKEVADQVIFMADGHIIEQGTPEELFDHPKNERTKRFIK
QVGEPAELI
NT seq 750 nt   +upstreamnt  +downstreamnt
ttgataacagtaaaaaatattcgcaaagcgtttaaagatctcgtcgtgctcgacggaatc
gatctagaagtgaaacgcggagaagtggtggcaatcatcggtccgtccggttccggaaaa
tcaacgcttctccggtgcttaaatctattagagcgtccggatcaaggccttattgaaatc
ggagaagccaaactgaatgcggaaaagtttacacgcaaggaagcacatcggcttcgccag
caaacggccatggtctttcaaaactacaatctgtttaaaaataaaacggctctgcaaaac
attacagaagctttaatcgtggctcaacataaaccacgcgacgaagcgaaacgtattgga
atggagattctgaaacaagtcggtctggagcataaggctgacagctatccaatcacaatg
tccggcggccagcagcagcgaatcggcattgcgcgggcgcttgcggtcaatccgcatgcg
attttgctggatgaaccaacgtcagcgcttgaccctgagctcgtcacaggggtgcttcag
gtcatcaagtccattgcggaaaaacaaacaacgatgatcattgttacacacgaaatggcg
tttgcaaaagaggttgctgatcaagtgatttttatggcagacggccatattatcgagcag
ggaacgccagaggaactgtttgaccatccgaaaaacgaacggacgaaacgatttatcaag
caggtgggagagcctgcagagcttatataa

DBGET integrated database retrieval system