KEGG   Bacillus subtilis subsp. subtilis 168: BSU39490
Entry
BSU39490          CDS       T00010                                 

Symbol
yxeN
Name
(RefSeq) amino acid permease protein YxeN
  KO
K16962  putative S-methylcysteine transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU39490 (yxeN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39490 (yxeN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative S-methylcysteine transporter
    BSU39490 (yxeN)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 937554
NCBI-ProteinID: NP_391828
Pasteur: BG11890
BSORF: BG11890
UniProt: P54953 A0A6M3ZHY3
Position
complement(4058791..4059465)
AA seq 224 aa
MNTIDWEFMISAFPTLIQALPITLFMAIAAMIFAIIGGLILALITKNKIPVLHQLSKLYI
SFFRGVPTLVQLFLIYYGLPQLFPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDD
GQLEACLSVGMTKFQAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGK
MYASGNLKYFETYLAVAIVYWVLTIIYSILQDLFERAMSKPYRT
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaacacgattgattgggaattcatgatatcagcgttcccgactttaattcaggccctt
ccgatcaccttgtttatggcaatagcagctatgatttttgccattatcggaggacttatt
ctcgcactcattacaaaaaacaaaattccagtgcttcatcagctgtcaaagctgtatata
tcctttttccgaggcgtgccgacacttgtacagctgttcttaatctattacgggctgccg
cagctatttccagagatgagcaaaatgacagctctcacagctgccatcatcgggttaagc
ttaaaaaacgcagcttatttggcagaaatcttccgggccgccctcaattctgttgatgac
gggcagctggaggcgtgcctgtctgtcggtatgacaaaatttcaggcatacagacggatt
attttgccgcaagcgatccgaaatgcgattccggcaacgggcaatacatttatcgggctc
ctgaaagaaacgtcactggcctttacattaggggtcatggagatgttcgcccaagggaag
atgtacgcttcaggaaacctcaaatattttgagacgtatttggcggttgcgatcgtctat
tgggttcttaccattatctacagcattttgcaggacttgtttgaacgtgccatgagcaag
ccataccggacttag

DBGET integrated database retrieval system