KEGG   Bacillus subtilis subsp. subtilis 168: BSU39500
Entry
BSU39500          CDS       T00010                                 

Symbol
yxeM
Name
(RefSeq) amino acid-binding protein YxeM
  KO
K16961  putative S-methylcysteine transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU39500 (yxeM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39500 (yxeM)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative S-methylcysteine transporter
    BSU39500 (yxeM)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd LPAM_2
Other DBs
NCBI-GeneID: 937568
NCBI-ProteinID: NP_391829
Pasteur: BG11889
BSORF: BG11889
UniProt: P54952 A0A6M3ZKF2
Position
complement(4059488..4060282)
AA seq 264 aa
MKMKKWTVLVVAALLAVLSACGNGNSSSKEDDNVLHVGATGQSYPFAYKENGKLTGFDVE
VMEAVAKKIDMKLDWKLLEFSGLMGELQTGKLDTISNQVAVTDERKETYNFTKPYAYAGT
QIVVKKDNTDIKSVDDLKGKTVAAVLGSNHAKNLESKDPDKKINIKTYETQEGTLKDVAY
GRVDAYVNSRTVLIAQIKKTGLPLKLAGDPIVYEQVAFPFAKDDAHDKLRKKVNKALDEL
RKDGTLKKLSEKYFNEDITVEQKH
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaagatgaaaaaatggacagtgctggtcgttgctgcattattagcggtgctctcagct
tgcggcaatggaaacagcagcagtaaagaggatgacaatgtgcttcatgtcggtgcgaca
ggacaaagttacccatttgcttataaagaaaacggaaagctgacaggctttgacgtggaa
gtgatggaagcagtcgctaagaaaattgacatgaaactggactggaagctgcttgaattc
agcgggctgatgggagagcttcaaacaggcaagcttgacaccatttccaaccaggtagct
gtgacagacgaacgtaaggaaacgtataactttacgaaaccatacgcttatgcgggaaca
cagattgtcgtcaaaaaagacaatacagacatcaaatcagtagacgatttaaaaggcaag
acagtcgcagccgttctcggttcaaaccacgcgaaaaaccttgaaagcaaagatcctgat
aaaaaaatcaatatcaaaacgtacgaaacacaagagggtacgctgaaggatgttgcgtac
ggccgtgtagacgcttatgtcaacagccgaactgtattgatcgcgcaaatcaagaagacc
ggtttgccattaaagcttgcaggagatccgattgtttacgaacaggttgcattcccattt
gccaaggacgatgcgcacgacaagctccgcaaaaaagtcaataaggccctagatgaattg
cgtaaagacggaacactgaaaaaactctctgaaaaatactttaatgaagatatcacagta
gaacagaagcattaa

DBGET integrated database retrieval system