KEGG   Bacillus subtilis subsp. subtilis 168: BSU39520
Entry
BSU39520          CDS       T00010                                 

Symbol
yxeK
Name
(RefSeq) monooxygenase YxeK
  KO
K24116  N-acetyl-S-(2-succino)cysteine monooxygenase [EC:1.14.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU39520 (yxeK)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     BSU39520 (yxeK)
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-GeneID: 937570
NCBI-ProteinID: NP_391831
Pasteur: BG11887
BSORF: BG11887
UniProt: P54950 A0A6M3ZLS6
Position
complement(4060818..4062143)
AA seq 441 aa
MTSKKKQIKLGVFLAGTGHHVASWRHPDAPSDASMNLDYFKELAKTAERGKLDMLFLADS
LSIDSKSHPNVLTRFEPFTLLSALAQVTSKIGLTATASTTYSEPFHIARQFASLDHLSNG
RAGWNVVTSSIESTALNFSGEKHLEHHLRYQRAEEFVEIVKGLWDSWEEDAFIRNKETGE
FFDKEKMHELNHKGEYFSVRGPLNVSRTPQGQPVIIQAGSSGDGKALAAKTAEVIFTAQN
HLESAQEFYQSIKEQAAEFGRDPEKIAIMPGIFPIIADTEEAAQAKYKELQDLIIPSVGL
QILQNYLGGIDLSAYPLDGPLPKLDAEASNAVKSRFKLVQEMAERDNMTIRELYKYVAGS
RGHHIFVGTPEQLADKMQEWVDTKACDGFNIMPPLLPEGIEVFVDQVVPILQERGVFRKE
YEGTTLREHFGLEKPVNRYAK
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgacaagcaaaaagaaacaaatcaaattaggggtatttttagcaggtacaggccatcat
gttgcgtcttggcggcacccggacgcgccgtcagatgcgagcatgaatttggattatttt
aaagagcttgcgaaaacagcggagcgaggcaagctggatatgctgtttttagcggacagc
ctttcaattgacagcaaatcacatccaaatgtattaacaaggtttgagccattcaccctg
ctctctgctttggcgcaggtcacatcaaaaatcggactgacagcaacagcctccactaca
tacagcgagccattccatattgccagacagtttgcgtcattggatcatctgtccaatggc
cgtgccggatggaacgtcgtcacttcatctattgaatcaacagcgctgaatttcagcggt
gaaaagcaccttgaacaccatttgcgctatcagcgggcagaggaatttgtcgagattgta
aaggggctttgggattcatgggaagaggacgcctttatccgtaataaagaaacgggtgaa
ttctttgacaaagaaaaaatgcatgagctgaaccacaaaggagaatatttctcggttcgc
ggacctctaaacgtttcaagaaccccgcagggccagccggtcattatccaggcaggatca
tcaggagacggaaaagcgctggctgccaaaacagccgaagtgatcttcacagcacaaaac
cacctggaatcagctcaagaattttatcaatccattaaagaacaggctgcggaattcgga
cgtgatccagaaaaaattgccattatgccgggtattttcccaatcattgccgatacagaa
gaagcagcgcaagccaaatacaaggagctccaagatctgattatcccatctgtcggtctg
caaattctccaaaattacttaggcggaattgatttgtcggcatatccgcttgatgggccg
ctgccgaagcttgacgccgaagcttccaatgcggtgaagagccgcttcaagcttgttcag
gagatggctgaacgtgacaatatgacgatacgagagctttacaaatacgttgcaggctcc
agaggccaccatatcttcgtcggcacgccggagcagctcgccgacaagatgcaggaatgg
gtggatacgaaagcgtgtgacgggtttaacatcatgcctccgcttcttccagaaggaatt
gaagtgtttgttgatcaagtggttccgattttacaggagcgcggcgtgttcagaaaagaa
tatgaaggcacaacattacgagagcacttcggtttggaaaagccggtaaaccgctatgca
aagtaa

DBGET integrated database retrieval system