KEGG   Bacillus subtilis subsp. subtilis 168: BSU39530
Entry
BSU39530          CDS       T00010                                 

Symbol
yxeJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937574
NCBI-ProteinID: NP_391832
Pasteur: BG11886
BSORF: BG11886
UniProt: P54949 A0A6M3ZIU6
Position
complement(4062329..4062556)
AA seq 75 aa
MSLINSHQSADSGLNIWSQLFFYTIVTASEWIGGLQKRRKGKGNGEILYEIIGRKLSLCF
IRLSFLADIEVALVE
NT seq 228 nt   +upstreamnt  +downstreamnt
atgagcttaattaattcacatcaatcagctgattccggtttgaatatctggagtcagctg
tttttttatacaatcgttacggcgtctgaatggataggcggtttgcaaaagcgaagaaaa
ggcaaaggaaatggcgaaatcttatatgaaattattggaagaaaactgagtctttgcttc
attagactcagttttcttgccgatatagaggttgcactagttgaatga

DBGET integrated database retrieval system