KEGG   Bacillus subtilis subsp. subtilis 168: BSU39540
Entry
BSU39540          CDS       T00010                                 

Gene name
yxeI
Definition
(RefSeq) hypothetical protein
  KO
K24041  penicillin V amidase [EC:3.5.1.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00311  Penicillin and cephalosporin biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    BSU39540 (yxeI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU39540 (yxeI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.11  penicillin amidase
     BSU39540 (yxeI)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C59
   BSU39540 (yxeI)
SSDB
Motif
Pfam: CBAH
Other DBs
NCBI-GeneID: 937573
NCBI-ProteinID: NP_391833
Pasteur: BG11885
BSORF: BG11885
UniProt: P54948 A0A6M4JQT3
Structure
PDB: 
2OQC

Position
complement(4062543..4063529)
AA seq 328 aa
MCTSLTLETADRKHVLARTMDFAFQLGTEVILYPRRYSWNSEADGRAHQTQYAFIGMGRK
LGNILFADGINESGLSCAALYFPGYAEYEKTIREDTVHIVPHEFVTWVLSVCQSLEDVKE
KIRSLTIVEKKLDLLDTVLPLHWILSDRTGRNLTIEPRADGLKVYDNQPGVMTNSPDFIW
HVTNLQQYTGIRPKQLESKEMGGLALSAFGQGLGTVGLPGDYTPPSRFVRAVYLKEHLEP
AADETKGVTAAFQILANMTIPKGAVITEEDEIHYTQYTSVMCNETGNYYFHHYDNRQIQK
VNLFHEDLDCLEPKVFSAKAEESIHELN
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgcacaagtcttacattggaaactgctgaccgtaaacatgtattagcaagaacaatg
gattttgcatttcagctggggacagaggtgattctctatccgcgccgttacagctggaac
agtgaagctgacggaagggcccatcagacacagtacgcgtttatcggtatggggagaaaa
cttggaaatatattatttgccgacggcattaatgaaagcggtttatcttgtgcggcgctt
tattttccgggctatgcggagtacgaaaaaacgatacgggaagataccgttcacattgtc
ccgcatgagtttgtgacatgggtgctgtcagtctgtcagtctttggaagacgtaaaagaa
aagattcgatctttaacgattgtagagaaaaaattagatctattggatacagttttaccg
cttcactggatattgtcagaccggacgggccgaaacctgacgatagaaccaagagcagac
ggcctcaaagtctatgataatcaacctggtgtcatgacgaacagccccgactttatatgg
catgtaaccaatctgcagcaatatacaggaatcagaccgaagcaattagagagcaaagag
atgggcggattagccctttctgcttttggccaaggcttaggaactgttggtctgccgggg
gattatacaccgccttcccggtttgtcagagctgtttatttgaaagaacatctagagccg
gcggccgatgaaacgaaaggtgtaacagccgcttttcaaattttggcaaatatgacgata
ccaaagggcgcagtgataacggaagaagacgaaattcattatacgcaatatacttccgtg
atgtgcaacgaaactggaaactactatttccaccactatgacaatcggcaaatccaaaaa
gtaaatttatttcatgaagaccttgactgtttggagcctaaagtgttttccgctaaagca
gaagagagtattcatgagcttaattaa

DBGET integrated database retrieval system