KEGG   Bacillus subtilis subsp. subtilis 168: BSU39550
Entry
BSU39550          CDS       T00010                                 

Symbol
yxeH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Hydrolase_6 HAD HAD_2 DUF4846
Other DBs
NCBI-GeneID: 937571
NCBI-ProteinID: NP_391834
Pasteur: BG11884
BSORF: BG11884
UniProt: P54947 A0A6M3ZI19
Position
complement(4063684..4064496)
AA seq 270 aa
MYKLIAIDMDGTLLNDHHEVTEEVRDALHAAKAEGVKIVLCTGRPIGGVQRYLDELNLIE
EGDYVIAYNGALVQNTHTNEVVSELSLGYDDLTSLYDLSLELKTPMHFFDSSNLYTPNRD
ISEFTVYESYVTQVPLHFRKIDEVPKDILIPKVMFIDKPENLSRVITSIPKDVREKYTMV
RSAPFFYEILHSEASKGNAVRQLAQLLGIEQAEVMCIGDNGNDLTMIEWAGCGVAMANAI
PEVLEAANFQTRSNNEHGVAHAIHELVLAK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtacaaactaattgcaattgatatggatggaacacttttaaatgatcatcatgaagta
acagaggaggtccgcgacgcccttcacgcggcaaaagcggaaggtgtcaaaattgtgctt
tgcaccggccggcctatcgggggtgtgcagagatatttagatgaactgaatttaattgaa
gaaggcgactatgttattgcgtataatggagcacttgttcaaaatacgcatacaaatgaa
gtggtctcagagctgtctctcggttatgatgatttgacttcattatatgacctgagctta
gagctgaagacgccgatgcatttctttgactcatctaatttgtatacgcctaaccgggat
attagcgaatttaccgtatacgaatcctatgtgacacaggtgccgcttcatttccgcaag
attgacgaggtgccaaaagatatcctcatcccgaaagtgatgtttattgataaaccggag
aacttaagccgcgtcattacatcgattccaaaagacgtgagagaaaaatatacaatggtc
agaagcgcgcctttcttttatgaaattctgcactcggaagccagcaaaggaaatgctgta
cgccagctggctcagctgcttggaattgaacaggcggaagtcatgtgcataggcgacaac
gggaacgacctgacaatgatcgaatgggcgggctgcggggttgccatggcaaacgccatc
ccagaagtattggaagcagcaaactttcaaacacgctccaataatgaacatggcgttgca
catgcgattcacgagcttgttttggctaaataa

DBGET integrated database retrieval system