KEGG   Bacillus subtilis subsp. subtilis 168: BSU39560
Entry
BSU39560          CDS       T00010                                 

Symbol
yxeG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF973 DUF4064
Other DBs
NCBI-GeneID: 937586
NCBI-ProteinID: NP_391835
Pasteur: BG11883
BSORF: BG11883
UniProt: P54946 A0A6M3ZI54
Position
complement(4064536..4065093)
AA seq 185 aa
MRNQKAERLVAAGLVLHIIQWIFILWAFLKVKHLFSDYTIYNPNVISGSMQSLSFIQMMR
AMMYSGAIVNYVLFFALVLLIYGIVLHAILIVLEMAAYVMIRRNPSSSWGFFFIAAGVKL
AILNITGIPFLAAGFLLMKQKKAENGVKAERKRKPRLRIRRQGRRLNRIRRKPSLPVEYQ
KEKTI
NT seq 558 nt   +upstreamnt  +downstreamnt
atgagaaatcaaaaagctgaaagactggtggcagcggggcttgttttacatatcattcaa
tggatatttatattatgggcttttctcaaagtcaaacatttatttagtgactatacgatc
tataaccctaatgtcatcagcggctccatgcagtccttatcgtttatacaaatgatgcgc
gctatgatgtactcaggggcaatcgtgaattatgttttgttttttgcccttgtattgctg
atttatggcatagtgcttcatgccatcctgatcgttctggaaatggcggcttacgtcatg
atcagacggaatccatcatcttcatgggggttctttttcatcgcggcgggtgtgaagctt
gccatcttgaatataaccggcattccttttctagctgccggctttctgctgatgaaacag
aaaaaagcagaaaacggcgtcaaggcagaaagaaagcggaaaccgcgcttgcgtatccga
agacaagggcggcgtctaaacagaatccggagaaaaccatctcttccggttgaatatcaa
aaagaaaaaacgatatga

DBGET integrated database retrieval system