KEGG   Bacillus subtilis subsp. subtilis 168: BSU39590
Entry
BSU39590          CDS       T00010                                 

Gene name
yxeD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TPR_MLP1_2 DUF745 FliJ OmpH Tweety
Other DBs
NCBI-GeneID: 937597
NCBI-ProteinID: NP_391838
Pasteur: BG11880
BSORF: BG11880
UniProt: P54943 A0A6M4JQY4
Position
4066210..4066563
AA seq 117 aa
MHNTQHGLQQLNQCRQTAQQLIQQTQQSSQQYRQMLHQEQQNIQMLQQILNHEQQAAHTI
QQALHGHDMAIQKCQQVVNMCNQMQQELTGQSSVMNTNVSTLPFGQNTTFQQQSYQQ
NT seq 354 nt   +upstreamnt  +downstreamnt
atgcataatacacaacacggcttgcagcagctgaaccaatgccgccaaactgctcagcag
ctcattcagcaaacacagcaaagcagccagcaatatcgccaaatgcttcatcaggaacag
caaaacatccaaatgctgcagcagattctaaaccacgaacaacaagctgcacataccatt
cagcaagcactgcacgggcatgacatggcgattcaaaagtgccagcaggttgtcaacatg
tgcaaccaaatgcaacaggaacttactggacaatccagcgtcatgaatacgaatgtgtct
acacttccattcggccaaaacacgacatttcagcagcaatcctaccagcagtaa

DBGET integrated database retrieval system