KEGG   Bacillus subtilis subsp. subtilis 168: BSU39600
Entry
BSU39600          CDS       T00010                                 

Symbol
yxeC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GPI2
Other DBs
NCBI-GeneID: 937578
NCBI-ProteinID: NP_391839
Pasteur: BG11879
BSORF: BG11879
UniProt: P54942 A0A6M3ZKF7
Position
complement(4066607..4067005)
AA seq 132 aa
MGITKRGAAWEWLHSWWMLFIFMPFAITSFFAFLFIGIKVRNRKWIMYGIIYFFIFAFGF
VLPDLPGVFIVVPLWAVTIIHGFKVRPLYLIQLDVYKDHVEARAFAEARSEAESRFHAPK
QSIQDIHIRKEQ
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggaattacaaaaagaggtgccgcttgggaatggctgcatagctggtggatgctgttt
attttcatgccttttgccattaccagtttttttgcctttttatttattggcatcaaggtt
agaaatagaaagtggatcatgtacggcatcatttattttttcatttttgcgtttggtttt
gttttgcccgatctgcccggtgtttttattgtggtcccgttatgggcggtaaccattatt
catggatttaaagtgcgcccgctgtatttgattcagctggatgtctacaaagatcatgtg
gaggcgcgggcttttgccgaggcaagaagtgaagccgagagcagatttcatgcaccgaaa
cagtctattcaggatatacatattcgcaaagaacagtaa

DBGET integrated database retrieval system