KEGG   Bacillus subtilis subsp. subtilis 168: BSU39610
Entry
BSU39610          CDS       T00010                                 

Symbol
yxeB
Name
(RefSeq) iron(3+)-hydroxamate-binding protein YxeB
  KO
K25308  ferric hydroxamate/heme transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39610 (yxeB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate/heme transporter
    BSU39610 (yxeB)
SSDB
Motif
Pfam: Peripla_BP_2 LPD5 DUF4969
Other DBs
NCBI-GeneID: 937581
NCBI-ProteinID: NP_391840
Pasteur: BG11878
BSORF: BG11878
UniProt: P54941 A0A6M4JQW0
Position
4067183..4068148
AA seq 321 aa
MKKNILLVGMLVLLLMFVSACSGTASKGSSSDSASEKTEMRTYKSPKGNVNIPAHPKRIV
TDFYAGELLSVGANVVGSGSWSFDNPFLKSKLKNVKDVGDPISVEKVMELQPDLIVVMNE
ENVDKLKKIAPTVVIPYNTAKNVEDTVSMFGDIAGAKDQAKSFMADFNKKAEAAKKKIAG
VIDKDATFGIYENTDKGEFWVFNDNGGRGGQAVYNALGLKAPEKIEQDVIKKGEMKQLSQ
EVIPEYAADYMFITDYNPKGESKTLDKLENSSIWKNLDAVKHNRVFINDFDSFYPYDPIS
VSKQVDIITDMLIKRAEENKK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaaaaagaacatattgctcgtgggcatgcttgtgctgcttctcatgtttgtcagcgct
tgcagcggcacggcttctaaagggagctcaagcgattctgcttccgaaaaaacagaaatg
agaacatacaaatcaccaaaagggaacgtcaacattcctgcacatccgaaacgcatcgtc
actgatttttatgccggtgaattgctgtctgtcggggccaatgtggtcggctcaggctca
tggtcatttgataatccgtttttaaaatcaaagctgaaaaatgtgaaggatgttggtgat
ccaataagcgttgaaaaagtgatggagcttcagcctgacttaattgttgtcatgaatgaa
gagaatgttgataaattaaagaaaatcgctccgactgttgtcataccttataacacagcg
aaaaacgtagaagacacagtcagcatgttcggagatatcgccggagcgaaagaccaagca
aaatcctttatggctgactttaacaaaaaagcggaagcagctaagaagaaaattgccggc
gtcatcgacaaagatgcaaccttcggcatttatgaaaacacagacaagggcgaattctgg
gtgttcaatgacaatggcggacgcggcggccaagctgtatacaatgcacttgggttaaaa
gcgcctgaaaaaattgagcaagatgtcatcaaaaaaggagagatgaaacagctctctcaa
gaggttattcctgagtatgccgcagattatatgttcattacggattacaacccgaaaggc
gaaagcaaaacactcgacaagctggagaattcctccatttggaaaaatcttgacgctgtt
aaacataatcgcgtgtttatcaatgactttgactcgttctacccgtacgacccgatttct
gtcagcaaacaggtggatatcatcaccgacatgctgatcaaacgggccgaagaaaataaa
aaataa

DBGET integrated database retrieval system