KEGG   Bacillus subtilis subsp. subtilis 168: BSU39620
Entry
BSU39620          CDS       T00010                                 

Symbol
yxeA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1093
Other DBs
NCBI-GeneID: 937612
NCBI-ProteinID: NP_391841
Pasteur: BG11877
BSORF: BG11877
UniProt: P54940 A0A6M3ZLT5
Structure
Position
complement(4068189..4068536)
AA seq 115 aa
MKKAMAILAVLAAAAVICGLLFFHNDVTDRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTL
DGYNASGKKEEVTFFAGKELRKNAYLKVKAKGKYVETWEEVKFEDMPDSVQSKLK
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaaaaagcaatggcaatcctggccgtcttggcggctgctgccgtaatatgcgggctt
ctcttttttcataacgatgttacagacagatttaatccgtttattcaccagcaagatgtc
tatgttcagattgatcgagatggcagacatcttagtccgggcggtactgaatatacatta
gacggatataatgcatccgggaaaaaagaagaagtgacctttttcgccggcaaagagctt
cggaagaacgcgtatttgaaggtgaaggcgaaaggaaagtatgtcgagacttgggaagaa
gtcaagtttgaagatatgccggactccgtacagtcaaaattaaagtga

DBGET integrated database retrieval system