KEGG   Bacillus subtilis subsp. subtilis 168: BSU39630
Entry
BSU39630          CDS       T00010                                 

Symbol
yxdM
Name
(RefSeq) ABC transporter permease
  KO
K11636  putative ABC transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU39630 (yxdM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39630 (yxdM)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Uncharacterized ABC transporter
    BSU39630 (yxdM)
SSDB
Motif
Pfam: FtsX
Other DBs
NCBI-GeneID: 937589
NCBI-ProteinID: NP_391842
Pasteur: BG11129
BSORF: BG11129
UniProt: P42424 A0A6M3ZIV6
Position
complement(4068550..4070418)
AA seq 622 aa
MTFLQFAYKNVTRNKRAYLAFFLSSAFSVLIFFTFAMFLFHPALKEGYLNNIAKKGLTAA
EWMIFVFSFLFVLYSVNAFLKSRNKEFGILLMQGITPGQLRKLITAENMIIGVMSIAAGI
IGGFIFSKTFFTVGAYILEMDALPLYMPWKALGITACGFLLLFFFLSQFTILFVRSNTVI
KLIKGTGKVKPEPKPSVLLSLFGIACLCGGYGMVLKGNVHGAEPFIILLLTVIGTYFFFS
QSSIWILRALKKWKTFYLRGKNIIWVSDLVYRLKDNARLFFIVSIISAVAFTATGVLAMY
KSTVGAEESAYEMEYLSYSNNPKEQTHLKDIDHELKTHGFTYTKDKIDVSYVRYQEGETV
PPVYMISESDAAKYFHVKVNGLKEDEAVYFPGTYDRNFKNEAPDQLKLLNQKGELSDQKL
SVKEVKKPLISLNAIIAVNDQTFDQLKSLGDKASLYGYSYDHWKDSLEISQSLQNEIYGN
YIDVHSDFASKAGTYYDTVQLPSLSLFIGLFIAIVFFVAAASFLYFRLFTDLDEDRERYR
SLAKIGLSEREMAQSVTIQLAILFFFPFVIAVMHTLFALRTLAVEGYSDVAGPLSLTIGG
FFIFQLLFFLAVRSSYLKKMNK
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgacctttcttcagttcgcttataaaaacgtcacgagaaacaaaagggcctatcttgca
ttctttttaagcagcgccttttccgttttgattttctttacctttgcgatgttcctgttt
catccggcattaaaggaaggctacctgaataacatcgccaaaaaaggcttaaccgccgcg
gaatggatgatctttgttttttctttcttatttgttctgtattcggttaatgcatttttg
aaatcgagaaataaagaattcggcattctgctcatgcagggcatcacgccggggcagctg
agaaagctcattactgcggaaaatatgatcatcggcgtcatgtcaattgcagccggtatt
atcggaggattcattttttcaaagacgttctttacggtcggcgcttatattttagaaatg
gacgcgctgcctttgtatatgccttggaaagcgctcggtattacggcctgcggatttctg
ctcttatttttctttttatcgcagtttacgatcctttttgtcagatcaaatacggttatc
aaattaataaagggcactggcaaggttaaaccggagcctaagccgtccgtgcttctgtcc
ttattcggcatcgcctgtctgtgcggcgggtacggcatggttcttaaaggcaatgtccac
ggggccgaaccgtttatcattttactgctcaccgttatcggaacatatttctttttcagc
caaagcagcatatggattctgcgcgcgctgaagaagtggaaaaccttttatctgcgcggg
aaaaacatcatttgggtttctgaccttgtctatcgtctaaaagacaacgcccgcctgttc
tttattgtcagcattatttccgcggttgcgtttactgcgacaggcgtgctcgcaatgtac
aaatcgaccgtcggagcggaagagtccgcttatgaaatggagtatttatcttacagcaac
aatccaaaagaacagactcatttgaaagatattgaccatgaactgaaaacacacggtttt
acgtatacgaaagacaaaatagatgtttcctatgttcgctatcaggaaggagaaactgtt
ccccctgtttacatgatcagtgaatcggatgcggcaaaatacttccatgtcaaagtgaac
ggcctgaaagaagacgaggctgtctatttcccgggaacgtatgaccgcaatttcaaaaac
gaagcgccggatcagctgaagctgctgaaccaaaaaggggagctgtctgatcaaaaactg
tcggtaaaagaagtcaaaaaaccgctgatctcattgaatgctatcatcgcggtgaatgat
caaacctttgatcagctgaaatcactcggtgataaagcgtcattatacggctacagctat
gatcattggaaagacagtcttgagatcagccaatccttgcaaaatgagatttacggcaat
tatatcgacgtgcattctgattttgcttcaaaagcggggacttactatgatacggtgcag
ctgccgagcctgagtctatttatcggcctgtttatcgcaattgtattctttgtcgcggca
gcaagtttcttatatttcaggctgttcactgatttagatgaagaccgggagcgctaccgt
tcactggccaaaatcggcctgagtgagcgagaaatggcgcaaagcgtgacaatacaattg
gcgattcttttcttctttccatttgtcattgccgtcatgcatacactgtttgccttgaga
acattggctgtggaaggatattccgatgtagcggggccgctcagtctcaccatcggaggg
tttttcatttttcagcttctattcttcctcgcggtgcggtcaagctatttgaaaaaaatg
aacaagtaa

DBGET integrated database retrieval system